KEGG   Bordetella parapertussis 12822: BPP0914Help
Entry
BPP0914           CDS       T00140                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00071  Fatty acid degradation
bpa00280  Valine, leucine and isoleucine degradation
bpa00281  Geraniol degradation
bpa00310  Lysine degradation
bpa00360  Phenylalanine metabolism
bpa00362  Benzoate degradation
bpa00380  Tryptophan metabolism
bpa00410  beta-Alanine metabolism
bpa00627  Aminobenzoate degradation
bpa00640  Propanoate metabolism
bpa00650  Butanoate metabolism
bpa00903  Limonene and pinene degradation
bpa00930  Caprolactam degradation
bpa01100  Metabolic pathways
bpa01110  Biosynthesis of secondary metabolites
bpa01120  Microbial metabolism in diverse environments
bpa01130  Biosynthesis of antibiotics
bpa01212  Fatty acid metabolism
Module
bpa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPP0914
   00650 Butanoate metabolism
    BPP0914
  Lipid metabolism
   00071 Fatty acid degradation
    BPP0914
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPP0914
   00310 Lysine degradation
    BPP0914
   00360 Phenylalanine metabolism
    BPP0914
   00380 Tryptophan metabolism
    BPP0914
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPP0914
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPP0914
   00281 Geraniol degradation
    BPP0914
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPP0914
   00627 Aminobenzoate degradation
    BPP0914
   00930 Caprolactam degradation
    BPP0914
Enzymes [BR:bpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPP0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: CAE40322
GeneDB: BPP0914
UniProt: Q7W0Z2
Position
complement(987264..988061)
Genome map
AA seq 265 aa AA seqDB search
MSYEFIRVEHLGPVCRIYLNRPEVRNAQSRSLLRELDDAVRAAEADDAVRVLIIGAVGDH
FSAGHDLKSARVERPNPTVEERWEYEEEHFLEYCLRIHDLKKPTIAQVQGACIAGGYMVA
NMCDLIVCADNAFFSDPVAHSMGTASLEVLIHPWVMGMRKAKELIFTGARLPAAEALQIG
MINRVVPLAELEQATLELANTIAAAPPYGLRFTKRSLNRTWDAQGFRAAVQAHFDVHQLS
HVTEEFQAHLKRGLDSTIKRAKAVS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatgagttcatccgcgtcgagcatctcggcccggtctgccgcatctacctgaac
cgccccgaagtgcgcaacgcccagagccgctcgctgctgcgcgagctggacgacgccgtg
cgcgcggccgaagccgacgacgccgtgcgcgtgctcatcatcggcgcggtcggcgaccac
ttctcggccggccacgacctgaaatcggcccgcgtcgagcgccccaaccccaccgtggaa
gaacgctgggagtacgaggaagaacacttcctcgaatactgcctgcgcatccacgacctg
aaaaagcccaccatcgcccaggtccagggcgcctgcatcgccggcggctacatggtcgcc
aacatgtgcgacctgatcgtctgcgccgacaacgccttcttctcggacccggtagcgcac
tcgatgggcaccgccagcctggaggtgctgatccatccctgggtgatgggcatgcgcaag
gccaaggaactgatcttcaccggcgcgcgcctgcccgccgccgaggcgctgcagatcggc
atgatcaaccgcgtggtgccgctggccgaactggagcaggccacgctggagctggccaac
accatcgccgccgccccgccctacggcctgcgcttcaccaagcgctcgctgaaccgcacc
tgggacgcgcagggctttcgcgccgccgtccaggcccacttcgacgtgcaccagctctcg
cacgtcaccgaggaattccaggcccacctcaagcgcgggctggactccaccatcaagcgc
gccaaggccgtatcctga

DBGET integrated database retrieval system