KEGG   Bordetella parapertussis 12822: BPP1223Help
Entry
BPP1223           CDS       T00140                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPP1223 (recR)
DNA repair and recombination proteins [BR:bpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BPP1223 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BPP1223 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: CAE36525
GeneDB: BPP1223
UniProt: Q7WAY7
Position
1304135..1304785
Genome map
AA seq 216 aa AA seqDB search
MAARRAAGRAAVCAMDPQLPEPEPLIALIEALRRLPGVGVRSARRMAYHLLQHDLQGADM
LGRALSGAVQHLRHCARCNSFTEDEVCATCANPKRDPGLLCIVETPADQNMIESSHGYRG
LYYVLMGRIAPLEGVGPRELDFQRVIERACDGVVQEVILATNFTAEGETTAHFLGDALSE
RGLKVTRLARGVPAGSELEYVDAGTIAWALMERRST
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttggcggcccgccgggccgccgggcgcgctgctgtctgcgcgatggatccccaactcccc
gaacccgaaccgctgatcgccctgatcgaggcgttgcgccgcctgcctggcgtgggcgtg
cgctcggcccgccgcatggcctatcacctgctgcagcacgacctgcagggggccgacatg
ctgggccgcgcgctttccggcgccgtgcagcacctgcgccattgcgcgcgctgcaacagc
tttaccgaagacgaggtctgcgcgacctgtgccaatcccaagcgcgatcccggcctgctg
tgcatcgtcgagacgccggcggaccagaacatgatcgagtccagccacggctaccgcggg
ctgtactacgtgctgatgggacgcatcgcgccgctggaaggggtgggaccgcgcgagctc
gacttccagcgcgtcatcgagcgcgcctgcgacggcgtggtccaggaagtcatcctggcc
accaatttcaccgccgagggcgagacgacggcccacttcctgggcgatgccctgagcgag
cgcggcctgaaagtcacccggctggcgcgcggcgtgccggccggcagcgagctcgagtat
gtcgatgccggcaccattgcctgggccttgatggagcgccgttcgacctag

DBGET integrated database retrieval system