KEGG   Bordetella parapertussis 12822: BPP1776Help
Entry
BPP1776           CDS       T00140                                 

Gene name
bioA
Definition
(GenBank) adenosylmethionine-8-amino-7-oxononanoate aminotransferase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00780  Biotin metabolism
bpa01100  Metabolic pathways
Module
bpa_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BPP1776 (bioA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpa01007]
    BPP1776 (bioA)
Enzymes [BR:bpa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     BPP1776 (bioA)
Amino acid related enzymes [BR:bpa01007]
 Aminotransferase (transaminase)
  Class III
   BPP1776 (bioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAE37077
GeneDB: BPP1776
UniProt: Q7W9I3
Position
1902938..1904212
Genome map
AA seq 424 aa AA seqDB search
MSDTTPAWMAQGYPHIWLPYAQMKTAAPPLPVVRSHGSLLELADGRTLIDGVASWWTACH
GYNHPHIAQAVREQLDRMPHVMFGGLAHEPALNLASRLSALLGPGLERVFYTDSGSVAVE
VAMKMAVQFWLNQGERGRTRFVAFRGGYHGDTFGTMAVCDPDEGMHAMFRGLLPEHDVLA
LPRDEAALAALQAHLERHAGRIAGMLVEPLVQGAGGMLLHDPQVLARLRELADRYGILLI
FDEIFTGFGRTGTMFAFEQAGVRPDIITLSKALTGGTLPLAATVASARVFEGFWSDDPGH
ALMHGPTFMGCALACAAANASLDLFEREPRLRQVAALEQALRAGLEPCRDLPWVRDVRVL
GAIGVIELDGIGARDDLRRRLVDAGVWVRPFGNIVYLTPAFTIAEDELQALLAAVRQVVA
ERRP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccacgcctgcctggatggcccagggctatccccatatctggctgccctat
gcgcagatgaagaccgccgcgccgccgctgccggtggtgcgcagccacggcagcctgctg
gagctggccgacggacgcacgctgatcgacggcgtggcctcgtggtggacggcctgccat
ggctacaaccaccctcatatcgcccaggcggtgcgcgagcagctggaccgcatgccgcat
gtgatgttcggcggcctggcgcacgagccggcgctgaacctggccagccgcctgagcgcg
ctgctgggaccggggctggaacgcgtcttctacaccgattcgggttcggtggcggtggag
gtggccatgaaaatggccgtgcagttctggctcaaccagggcgagcgcggccgcacgcgc
ttcgtggcgtttcgcggcggctaccatggcgataccttcggcaccatggcggtgtgcgac
ccggacgaggggatgcacgccatgttccgcggcctgttgcccgagcacgacgtgctggcg
ctgccgcgcgacgaggcggcgctggcggccctgcaggcgcacctggagcgccatgccggg
cggatcgccggcatgctggtcgaacccctggtgcagggcgccggcggcatgctgctgcac
gatccgcaggtgctcgcgcggttgcgcgaactggccgaccgatacggcatcctgttgatt
ttcgacgagatcttcaccggcttcggacgcacgggcacgatgttcgccttcgagcaggcc
ggggtgcggcccgacatcatcaccctgtccaaggcgctgaccggcgggacgctgccgctg
gcggccacggtggccagcgcgcgcgtcttcgaggggttctggtccgacgaccccggccat
gcgctgatgcacggcccgaccttcatgggctgcgcgctggcctgcgcggcggccaacgcc
tcgctcgacctgttcgagcgcgagccgcggctgcgccaggtggcggcgctggagcaggcg
ctgcgcgccgggctggagccctgccgcgacctgccctgggtgcgcgatgtgcgggtgctg
ggcgccatcggcgtgatcgaactcgacggcatcggcgcgcgcgacgacctcaggcgccgc
ctggtcgacgccggggtgtgggtgcggccttttggcaacatcgtgtacctgacgccggcc
ttcaccattgccgaggacgaattgcaggcgctgctggcggcggtgcggcaggtcgtggcc
gaacgccgcccctag

DBGET integrated database retrieval system