KEGG   Bordetella parapertussis 12822: BPP2819Help
Entry
BPP2819           CDS       T00140                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00071  Fatty acid degradation
bpa00072  Synthesis and degradation of ketone bodies
bpa00280  Valine, leucine and isoleucine degradation
bpa00310  Lysine degradation
bpa00362  Benzoate degradation
bpa00380  Tryptophan metabolism
bpa00620  Pyruvate metabolism
bpa00630  Glyoxylate and dicarboxylate metabolism
bpa00640  Propanoate metabolism
bpa00650  Butanoate metabolism
bpa00900  Terpenoid backbone biosynthesis
bpa01100  Metabolic pathways
bpa01110  Biosynthesis of secondary metabolites
bpa01120  Microbial metabolism in diverse environments
bpa01130  Biosynthesis of antibiotics
bpa01200  Carbon metabolism
bpa01212  Fatty acid metabolism
bpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPP2819
   00630 Glyoxylate and dicarboxylate metabolism
    BPP2819
   00640 Propanoate metabolism
    BPP2819
   00650 Butanoate metabolism
    BPP2819
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BPP2819
   00072 Synthesis and degradation of ketone bodies
    BPP2819
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPP2819
   00310 Lysine degradation
    BPP2819
   00380 Tryptophan metabolism
    BPP2819
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPP2819
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPP2819
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BPP2819
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpa04147]
    BPP2819
Enzymes [BR:bpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BPP2819
Exosome [BR:bpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPP2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAE38111
GeneDB: BPP2819
UniProt: Q7W6T1
Position
3020224..3021420
Genome map
AA seq 398 aa AA seqDB search
MATGIKDRVAILAMGCSRFGERWDVGQEELMVEAYAEALASVGIEPRAIEAAWYSSHYDD
IGAGKAGTPMAMALRLPDIGVTRVENFCAGGTEAFRGAVYAVASGAADIALALGVEKLKD
TGFAGLPLASRGTLAPMYLPTHSNPGNFAQLARAYQARHGVSREDLKAAMAHTSVKSHAN
ALHNPKAHLRKAISREQAAGAPLVADPIGLFDCCPVSDGAACAIVTTPEIARSLNRGPLV
LVKAIQLATSNGWELQQSDWDGSYVHTTRVAARKAYAEAGIDDPRAQLSLTELHDCFSIT
ELVTLEDIGLAEPGTAWRGMLDGRFDADGALPCQIDGGLKCFGHPVGASGLRMLYEAWLQ
LSGRAGARQLPAPSLALTHNLGGAPAQNVCSITILGAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaatcaaggatcgcgtcgccattctggcgatgggctgttcccgtttcggc
gaacgctgggacgtgggccaggaagaattgatggtcgaggcctacgccgaggcgctcgcc
agcgtcggcatcgagccgcgcgccatcgaggcggcctggtactcgtcgcattatgacgac
atcggcgcgggcaaggccggcacgcccatggccatggccctgcgcctgcccgacatcggc
gtgacgcgcgtggagaacttctgcgccggcggcaccgaggcatttcgcggcgccgtctac
gcggtcgcctccggcgccgcggacatcgcgctggcgctcggggtggaaaagctgaaagac
accggcttcgccggcctgccgctggcctcgcgcggcacgctggcgcccatgtacctgccc
acgcacagcaacccgggcaacttcgcgcagctggcgcgcgcctaccaggcccgccacggc
gtctcccgcgaagacctcaaggcggccatggcccatacctcggtgaaaagccatgccaac
gccttgcacaatcccaaggcgcacctgcgcaaggccatcagccgcgaacaggccgccggc
gcgccgctggtggccgaccccatcggactgttcgattgctgtccggtgtcggacggcgcc
gcctgcgccatcgtcaccacccccgagatcgcccgcagcctgaaccgcggcccgctggtc
ctggtcaaggccatccagctggccacgtccaacggctgggagctgcagcaatcggactgg
gacggctcgtacgtgcacaccacccgcgtggcggcgcgcaaggcgtacgccgaagcgggc
atcgacgatccgcgcgcgcagctcagcctgaccgaattgcacgactgcttctcgatcacc
gaactggtgacgctggaagacattggcctggccgagcccggcacggcctggcgcggcatg
ctcgacggccgcttcgacgccgacggggcgctgccctgccagatagacggcggcctgaaa
tgcttcggccatcccgtgggggcctcggggctgcgcatgctctacgaggcctggctgcaa
ctgagcggccgcgccggcgcgcgccagctgcccgcgccctcgctggccctgacccacaat
ctgggcggcgcgcccgcgcagaacgtgtgttcgatcacaatactcggcgcggcctga

DBGET integrated database retrieval system