KEGG   Bordetella parapertussis 12822: BPP3274Help
Entry
BPP3274           CDS       T00140                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00010  Glycolysis / Gluconeogenesis
bpa00620  Pyruvate metabolism
bpa00640  Propanoate metabolism
bpa00680  Methane metabolism
bpa01100  Metabolic pathways
bpa01110  Biosynthesis of secondary metabolites
bpa01120  Microbial metabolism in diverse environments
bpa01130  Biosynthesis of antibiotics
bpa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP3274
   00620 Pyruvate metabolism
    BPP3274
   00640 Propanoate metabolism
    BPP3274
  Energy metabolism
   00680 Methane metabolism
    BPP3274
Enzymes [BR:bpa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BPP3274
Lipid biosynthesis proteins [BR:bpa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BPP3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAE38559
GeneDB: BPP3274
UniProt: Q7W5L7
Position
complement(3530862..3532907)
Genome map
AA seq 681 aa AA seqDB search
MAIRLRVGKKNGSTRIIHRRHTMSNAIQSVLVENRVFPPPASAVQGAAISGMDAYWALCE
EADKDFNGFWSRLARENLQWSKPFTQVLDESEAPFYRWFGDGELNVSANCLDVHLHNGNA
DKTAIIFESDDGKVDKISYRELLARVCRFANGLKAMGYKKGDRAIIYMPMSIEAVVAMQA
CARLGVTHSVVFGGFSAKSLQERIVDVGATVVITADEQVRGGKTIPLKPAVEEAFAMGGC
EAVSKVVVYRRTGGKIAWQEGRDVWMHDVEAGQADTCEPQAVNAEHPLFILYTSGSTGKP
KGVQHASAGYLLWALLTMKWTFDARADDVYWCTADVGWVTGHTYITYGPLAAGVTQVVFE
GVPTFPNAGRFWDMIARHKVSVFYTAPTAIRSLIKAAEANQEVHPRQYDLDSLRIIGSVG
EPINPEAWIWYHKNVGRERCPVVDTWWQTETGGHMLTPLPGATSLKPGSCTLPLPGIVAA
IVDETGGDVAQGNGGFLVIKRPWPAMIRNIWGDPERFKKSYFPPELRGYYLAGDGAQRDA
DGYFWIMGRIDDVLNVSGHRLGTMEVESALVAHEMVAEAAVVGRPDDTTGEAVVAFVVLK
RSRPEGDEAQAIARQLRDWVGKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRVVAKGEE
ITQDVSTLENPAILEQLAKPL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
gtggcgatacggttgcgtgtcggcaagaaaaacggcagcaccagaatcattcatcggaga
cacaccatgtcgaatgccattcaatccgtcctggtcgagaatcgcgtattcccgccgccg
gcgagcgccgtgcaaggcgccgcgatttcgggcatggacgcctattgggccctgtgcgag
gaagcggacaaggatttcaacgggttctggtcgcgcctggcgcgcgagaacctgcaatgg
agcaagcccttcacccaggtcctggacgagtccgaggcgcctttctatcggtggttcggc
gatggcgaactcaacgtatcggccaactgcctggacgtgcacctgcataacggcaacgcc
gacaagaccgccatcatcttcgaatccgacgacggcaaggtcgacaagatcagctaccgc
gaactgctggcgcgcgtgtgccgcttcgccaatggcctgaaggccatggggtacaagaag
ggcgaccgcgccatcatctacatgcccatgtcgatcgaggcggtggtggccatgcaggcc
tgcgcccgcctgggcgtgacccactcggtggtgttcggcggcttctcggccaagagcctg
caggagcgtatcgtcgacgtcggcgccacggtggtgatcaccgccgacgagcaggtgcgc
ggcggcaagaccatcccgctcaagcccgccgtcgaggaagcgttcgccatgggcggttgc
gaggccgtttccaaggtggtggtgtatcgccgcaccggcggcaagatcgcctggcaggaa
gggcgcgatgtctggatgcacgacgtggaagccggccaggccgatacctgcgagccgcag
gcggtcaatgccgagcatccgttgttcatcctgtacacgtcgggctccaccggcaagccc
aagggcgtgcagcatgcctccgcgggctatctgctgtgggcgctgctgaccatgaagtgg
accttcgacgcccgcgccgatgatgtgtactggtgcacggccgacgtgggctgggtgacc
ggccatacctatatcacctacggcccgctggccgccggcgtgacgcaggtggtgttcgag
ggcgtgcccacgttccccaatgccggacgcttctgggacatgattgcgcgccacaaggtg
tcggtgttctataccgcgccgaccgcgatccgctcgctcatcaaggccgccgaggccaac
caggaggtgcacccgcgccaatacgacctggacagcctgcgcatcatcggttcggtgggc
gagcccatcaaccccgaggcctggatctggtaccacaagaacgtcggccgcgagcgctgc
ccggtcgtcgacacctggtggcagaccgagaccggcgggcacatgctcacgccgctgccg
ggcgccacgtcgctcaagccgggatcgtgcacgctgccgctgccgggcattgtcgcggcc
atcgtcgacgagaccggcggcgatgtcgcgcagggcaatggcggcttcctggtcatcaag
cgtccctggccggccatgatccgcaacatctggggcgacccggagcggttcaagaagagc
tacttcccgcccgagctgcgcggctactacctggccggcgacggcgcccagcgcgacgcc
gatggctatttctggatcatggggcgcatcgacgacgtgctcaacgtgtccggccaccgc
ctcggcaccatggaggtggagtcggcgctggtggcgcacgaaatggtggccgaggccgcc
gtggtgggccgtcccgacgacaccaccggcgaagccgtggtggccttcgtggtgctcaag
cgcagccgtcccgagggcgacgaagcccaggccatcgccaggcaactgcgcgactgggtg
ggcaaggaaatcggccccatcgccaagcccaaggacatccgtttcggcgacaacctgccc
aagacccgttcgggcaagatcatgcgccgcctgctgcgcgtggtcgccaagggcgaggaa
atcacccaggacgtgtccaccctggagaaccccgccatcctcgagcaactggccaagccg
ttgtga

DBGET integrated database retrieval system