KEGG   Bordetella parapertussis 12822: BPP4307Help
Entry
BPP4307           CDS       T00140                                 

Gene name
ptxE
Definition
(GenBank) pertussis toxin subunit 5 precursor
  KO
K11027  pertussis toxin subunit 5
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa05133  Pertussis
Module
bpa_M00574  Pertussis pathogenicity signature, pertussis toxin
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BPP4307 (ptxE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpa02000]
    BPP4307 (ptxE)
   02042 Bacterial toxins [BR:bpa02042]
    BPP4307 (ptxE)
Transporters [BR:bpa02000]
 Other transporters
  Pores ion channels [TC:1]
   BPP4307 (ptxE)
Bacterial toxins [BR:bpa02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Pertussis toxin (PT)
    BPP4307 (ptxE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pertus-S5-tox
Motif
Other DBs
NCBI-ProteinID: CAE39585
GeneDB: BPP4307
UniProt: Q7W2U7
Position
4639263..4639625
Genome map
AA seq 120 aa AA seqDB search
MHTIASILLSVLGIYSPADVAGLPTHLYKNFTVQELALKLKGKNQEFCLTAFMPGRSLVR
ACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcataccatcgcatccatcctgttgtccgtgctcggcatatacagcccggccgacgtc
gccggcctgccgacccatctgtacaagaacttcactgtccaggagctggccttgaaactg
aagggcaagaatcaggagttctgcctgaccgccttcatgccgggcagaagcctggtccgg
gcgtgcctgtccgacgcgggacacgagcacgacacgtggttcgacaccatgcttggcttt
gccatatccgcgtatgcgctcaagagccggatcgcgctgacggtggaagactcgccgtat
ccgggcactcccggcgatctgctcgaactgcagatctgcccgctcaacggatattgcgaa
tga

DBGET integrated database retrieval system