KEGG   Bordetella parapertussis 12822: BPP4310Help
Entry
BPP4310           CDS       T00140                                 

Gene name
ptlB
Definition
(GenBank) pertussis toxin transport protein
  KO
K12079  type IV secretion system protein PtlB
Organism
bpa  Bordetella parapertussis 12822
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP4310 (ptlB)
Secretion system [BR:bpa02044]
 Type IV secretion system
  Pertussis toxin exporter
   BPP4310 (ptlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB3
Motif
Other DBs
NCBI-ProteinID: CAE39588
GeneDB: BPP4310
UniProt: Q7W2U4
Position
4640774..4641088
Genome map
AA seq 104 aa AA seqDB search
MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDD
QQFRLIWLYLRMRWLSRDRTHAFWQSTVYAPLRYAERRRRLRKP
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatccgcttttcaagggctgcacccggcccgcgatgctgatgggcgtacccgcc
acgccgctggccgtgtgcagcggcaccattgccctgctgggcatctggttcagcatcgcc
tttctggccttgtttcccgtggcattgctggcgatgcggatcatgatccggcgcgatgac
cagcagttccgcctgatctggctttacctgcgcatgcgttggctgagccgggaccgcacg
catgcgttctggcaaagtaccgtctatgcgccgctgcgttacgccgagcgccgccggcgc
ctgcgcaagccatga

DBGET integrated database retrieval system