KEGG   Bordetella parapertussis 12822: BPP4313
Entry
BPP4313           CDS       T00140                                 

Definition
(GenBank) putative bacterial secretion system protein
  KO
K12081  type IV secretion system protein PtlE
Organism
bpa  Bordetella parapertussis 12822
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP4313
Secretion system [BR:bpa02044]
 Type IV secretion system
  Pertussis toxin exporter
   BPP4313
SSDB
Motif
Pfam: VirB8
Other DBs
NCBI-ProteinID: CAE39592
GeneDB: BPP4313
UniProt: Q7W2U0
Position
4645119..4645820
AA seq 233 aa
MPDPRPLTPDQTHGRGHAEAAVDWEASRLYRLAQSERRAWTVAWAALAVTALSLIAIATM
LPLKTTIPYLIEVEKSSGAASVVTQFEPRDFTPDTLMNQYWLTRYVAARERYDWHTIQHD
YDYVRLLSAPAVRHDYETSYEAPDAPDRKYGAGTTLAVKILSAIDHGKGVGTVRFVRTRR
DADGQGAAESSIWVATVAFAYDQPRALTQAQRWLNPLGFAVTSYRVDAEAGQP
NT seq 702 nt   +upstreamnt  +downstreamnt
atgccagacccgcgccccttgacgcctgaccagacgcatggccgcgggcatgccgaggcc
gcggtggactgggaagcgtcccgcctgtaccggctggcgcagtcggaacgccgtgcatgg
acggtggcgtgggcggcgctcgccgtgaccgcgctgtcattgatcgccatcgcgacgatg
cttccgctcaagaccaccattccttacctgatcgaggtcgaaaagagcagcggcgcggcc
tcggtcgtcacgcaattcgaaccccgagatttcaccccggacaccttgatgaaccagtac
tggctgacgcgctatgtcgcggcgcgcgagcgctacgattggcacacgatccagcacgat
tacgactacgtgcgcctgctgtccgcgcccgccgtcaggcacgattacgaaaccagctac
gaggcgcccgatgcgccggaccgcaagtacggcgctggcacgaccctggccgtgaaaatt
ctcagcgccatcgaccatggcaagggcgtcggcacggtgcgctttgtccggacacggcgc
gacgcggacgggcagggcgccgccgaatcctcgatatgggtagcgaccgtggcattcgcc
tacgatcagccgcgcgcgctgacccaggcccagcgctggctcaatccgctgggctttgcc
gtcaccagctatcgcgtcgacgcggaggctggacagccatga

DBGET integrated database retrieval system