KEGG   Borrelia parkeri: X966_03225Help
Entry
X966_03225        CDS       T03987                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
bpak  Borrelia parkeri
Pathway
bpak03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    X966_03225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bpak03400]
    X966_03225
Enzymes [BR:bpak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     X966_03225
DNA repair and recombination proteins [BR:bpak03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     X966_03225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma ASL_C
Motif
Other DBs
NCBI-ProteinID: AHE62945
Position
complement(672331..675552)
Genome map
AA seq 1073 aa AA seqDB search
MYKIYKTNKVSNIYNKIKELIKNDDIFKKETIIILKSNILSEEIKKYLATLNEVSYNLNV
KQNIIKTIYKLSIENHNIKKFLENNTLFLYSETEKFILYHMLKDNKIKNIKQFKSTKNRY
IFASKIITLFHKYYSKFPNLIDHWRQNKFLFEDQNKIHYESMQKEMFKKLFENQINLFNL
HEKIEQEITDTQQSIETKRIIIIGETREIDRKILHCLQKIFDITVYELILEDTTQIKSAF
IDELVPVKIKKCNSSTQIEEETDIQAFEEKNFLASFKNNITKGTPLLNLDNSFKIIEAKT
KKREVEILVNNILHSTQNNHLKINDIVVTYLPKDMDIYLPYIEEFLNKYELEFTILDSKD
VSKSKSVIALKQLMKLFISNKGTISNFNRKEIIEFLSNTKVMNKFNISISELEYLIKFND
AVNINFGMNDSHKESLSYDKNFLNSWENGFDRFLTSTMFNEKYECNNCQESISFQDPDSI
VRLISIIKSLYEDIMYFREQEYTIYEWAEIMDIFIDKYIKLEDNNKIDEYINTRIQYFKN
FSRDFNENLYKDYMTKVKDRKVNFALFKIMLEESIEQKAYQSNNQNTGILVASSDKIEYL
QKSEIHFLGIHKLNSNIHFDNMNLLNEYYDYVNLEQDNISNLIKIIFAASNKFYFYYSLS
ESLNPDINKPKVINKIINYIRDMGQELKIEIHPSENYDFEYFKDEKANYLINYDTEAFNI
AKSLQQGKYSNFKQKRLKLKKQITLRIEDINKAITNPYKYFYEEILNVYIKDISQIGDIK
KKQEEQIIDIDNFNYKLINNLIPIHECIKDETNEHILEKIDNIIENQIQKGIIPMNIKKT
TIKENFIEKFNEIKNNIVINFQEFFKMQETDIKLNKSIFINFEGETIEFKLNGKLKNIYK
IDNRYFYVNLEKKDYGQDKIIRKINLYIIGLMLKSSIENIESIQEIKITYKTSKLSLDNQ
YTNETINYLDLTNLLKQIAYISSYPTPIYKDLIQKSLIKIKNINEFPTVLKTQIKYPQTS
ININKDMEFILQQKDITWCPYYNRFKDTHDLDINDNLEKLLQDFYAKFIKVQS
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgtataagatatataaaacaaataaagtaagcaatatttataataaaattaaagagtta
attaaaaacgatgacatatttaaaaaagaaaccatcatcattttaaaaagtaacatttta
agcgaagaaattaaaaaatatctagcaaccctgaatgaggtctcatataacctcaatgta
aaacaaaacataataaaaacgatatataagctctcaatagaaaatcacaatataaaaaaa
tttttagaaaacaatacattgttcctttactcagaaacagaaaaatttattctgtatcac
atgttaaaagacaataaaataaaaaatatcaagcaatttaaatcgacaaaaaacagatat
atctttgcatcaaagataataactttatttcataaatactactctaaatttccaaatctg
attgatcattggagacaaaataaatttttatttgaagatcaaaataagattcactacgaa
tccatgcaaaaggaaatgtttaaaaaactatttgaaaatcaaataaacctttttaacttg
cacgagaaaattgaacaagaaataacagatactcagcaaagcattgaaacaaaaagaata
ataataattggagagactagagaaattgacagaaaaattttacattgtttgcaaaaaatt
ttcgacattacagtatacgaattaatacttgaagatacaactcaaatcaaatctgccttc
atagatgaactagtaccagtaaaaatcaaaaaatgcaattcaagtacacaaatagaagaa
gaaactgatattcaagcatttgaagagaaaaattttttagcaagtttcaaaaacaatatt
acaaaaggcactcctctattaaacttagataatagtttcaaaataatagaggcaaaaaca
aaaaaacgagaggtagaaattctagtaaataatattctacattcaacacaaaataatcat
ctcaaaataaacgatattgtagtaacttacctaccaaaagatatggacatatacttacca
tacatagaagaatttttaaataaatatgaacttgaatttactattttagattctaaagac
gtctcaaaaagtaaaagtgtaatagcattaaagcaattaatgaaactcttcatttcaaac
aaaggaacgattagtaattttaatagaaaagaaataattgaatttttaagtaacacaaaa
gtaatgaataaattcaacatctcaataagtgaattagaatacttaataaaatttaacgat
gcagtgaatattaattttggaatgaatgattctcataaagaaagcttatcttatgacaag
aattttttaaattcatgggaaaatggctttgatagatttctcacatctacaatgtttaat
gaaaaatatgaatgcaataattgtcaagagagcataagctttcaagatccagattcaata
gtaagattaataagcataataaaaagcctatatgaagatataatgtactttagagaacaa
gaatacacaatatatgaatgggcagaaataatggatattttcatagataaatatatcaaa
cttgaagataacaacaaaattgatgaatatataaacacaagaatacaatactttaaaaat
ttttcaagagattttaatgaaaacctttacaaagattacatgacaaaagttaaagacaga
aaagttaattttgctcttttcaaaataatgcttgaagaaagcatcgaacaaaaagcatat
caatcaaacaatcaaaatacaggtatacttgttgcaagctctgataaaatcgaatattta
caaaaatctgaaattcactttttaggaatccataaattaaactcaaacattcattttgac
aatatgaacttattaaacgaatattatgactatgtcaatctggaacaagataacatttca
aatttaattaagataatctttgcagcatcaaacaaattctatttctattactcactaagc
gaatctctaaatccagatatcaataaacctaaagtaataaataaaataataaattacata
agagatatgggacaagaactaaaaattgaaatacacccaagtgaaaattacgattttgaa
tacttcaaagacgaaaaagccaattacctaattaactatgacacagaagcctttaatatt
gcaaaatcactacaacaaggcaaatattcaaactttaaacagaaaagacttaaattaaaa
aaacaaatcacactaaggatagaagacataaataaagctataactaatccatacaaatac
ttttatgaagaaatattaaatgtatacattaaagatataagccaaattggtgatattaag
aaaaaacaagaagagcagattattgacattgataattttaattataagctaataaataat
ctcataccaatacatgaatgtataaaagatgaaactaatgaacatatattagagaaaata
gataatataattgaaaatcaaattcaaaagggaataattcccatgaatatcaaaaaaaca
accatcaaagaaaatttcatagaaaaattcaatgaaattaaaaataatattgttatcaat
tttcaggaatttttcaaaatgcaagaaactgacatcaaattaaataaaagcatattcatt
aacttcgaaggcgaaacaatagaatttaagttaaatggaaaactcaaaaacatatataaa
atagataatcgatatttttacgtcaatttagagaaaaaagattatggtcaagacaaaatt
atcagaaaaatcaacctatacataataggattaatgttaaaaagctcaattgaaaatata
gagtcaattcaagaaataaaaataacttataaaacttctaaattatcacttgataatcaa
tatacaaatgaaacgataaactacctagaccttacaaatttattaaaacaaatagcatat
atttcaagctatcctactcccatttataaagatttaatacaaaaaagtttaattaaaata
aaaaacataaacgaatttccaacagtactaaaaacacaaataaaatatccacaaacaagc
attaatattaacaaagatatggaattcattcttcaacaaaaagacataacatggtgtcca
tattataacagatttaaagacactcacgatttagacataaacgacaacttagaaaaatta
cttcaagatttttatgctaaattcatcaaggtacaaagttaa

DBGET integrated database retrieval system