KEGG   Bordetella parapertussis Bpp5: BN117_0152Help
Entry
BN117_0152        CDS       T02297                                 

Gene name
wlbB
Definition
(RefSeq) acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00520  Amino sugar and nucleotide sugar metabolism
bpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN117_0152 (wlbB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bpar01005]
    BN117_0152 (wlbB)
Enzymes [BR:bpar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     BN117_0152 (wlbB)
Lipopolysaccharide biosynthesis proteins [BR:bpar01005]
 Unusual sugar
  BN117_0152 (wlbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-GeneID: 13888188
NCBI-ProteinID: YP_006894237
UniProt: K0MCU0
Position
complement(161321..161896)
Genome map
AA seq 191 aa AA seqDB search
MTTIHPTAIVDEGARIGANSRIWHWVHICGGAEIGAGCSLGQNVFVGNRVRIGDRVKIQN
NVSVYDNVFLEDDVFCGPSMVFTNVYNPRAAIERKNEYRDTLVRQGATLGANCTIVCGAT
VGRYAFVGAGAVVNKDVPDFALVVGVPARQIGWMSRHGEQLDLPLAGNGQARCPHTGDLY
ILENGVCRLGE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatccatccgaccgccattgtcgatgaaggcgcccgcatcggcgccaacagc
cgcatctggcactgggtccacatctgcggcggcgccgagatcggcgcaggctgctcgctg
gggcagaacgtcttcgtcggcaaccgtgtgcggatcggcgaccgcgtgaaaatccagaac
aacgtgtcggtgtacgacaacgttttcctggaggacgacgtgttctgcggtccgagcatg
gtgttcaccaacgtctacaacccgcgcgcggccatcgaacgcaagaacgaataccgcgac
acgctggtgcgccagggcgccacgctgggcgccaactgcaccatcgtctgcggcgcgaca
gtgggccgctacgcctttgtcggcgccggcgcggtcgtcaacaaggacgtccccgatttc
gcactggtggtcggtgtgccggcgcgccagatcggctggatgagccgccacggcgaacag
ctcgacctgcccctggccggcaacggccaggcgcgctgcccccatacgggcgacctttat
atcctggaaaacggcgtctgccgactgggcgagtga

DBGET integrated database retrieval system