KEGG   Bordetella parapertussis Bpp5: BN117_0759
Entry
BN117_0759        CDS       T02297                                 

Definition
(RefSeq) lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BN117_0759
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpar02044]
    BN117_0759
Secretion system [BR:bpar02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN117_0759
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-GeneID: 13888795
NCBI-ProteinID: YP_006894785
UniProt: K0MAN2
Position
811435..811977
AA seq 180 aa
MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADPRVNPDASGRPSPIQV
TLYELRSSAEFEARDFFTLQGDAQAALGKSLIETDQVILQPGETRKLSYPGNTEARVVGI
VAAYRDLERSPWRIVVPLPQAQNTNIYKFWQFSPNEETVRVAVGGQGVQIVDRERSWWPF
NT seq 543 nt   +upstreamnt  +downstreamnt
ttgcttgttgctgtgcccacgcggcgcgcgttgcgcgcggcggcctggattgccgtcgcg
gtgctggccgccgggtgcgcgtccacggccagccgcaaggcggcgccttacgcgatcgag
ctgaaggccgatccgcgcgtcaatcccgatgcctcgggccggccctcgccgatccaggtc
acgctgtacgagctgcgttcgtccgccgagttcgaggcgcgcgatttcttcaccctgcaa
ggcgacgcgcaggccgcgctgggcaagtcgctcatcgaaaccgaccaggtcatcctgcag
cccggcgaaacccgcaagctgtcgtatccgggcaataccgaggcgcgcgtggtcggcatc
gtggcggcctatcgcgacctcgagcgcagtccctggcgcatcgtcgtgcccctgccgcag
gcccagaacaccaacatctacaagttctggcagttctcgcccaacgaggagaccgtgcgc
gtcgcggtgggcggacagggcgtgcaaatcgtcgaccgggagcgttcctggtggcccttc
tga

DBGET integrated database retrieval system