KEGG   Bordetella parapertussis Bpp5: BN117_0934Help
Entry
BN117_0934        CDS       T02297                                 

Gene name
ddlB
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00473  D-Alanine metabolism
bpar00550  Peptidoglycan biosynthesis
bpar01100  Metabolic pathways
bpar01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN117_0934 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN117_0934 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BN117_0934 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpar01011]
    BN117_0934 (ddlB)
Enzymes [BR:bpar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN117_0934 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bpar01011]
 Precursor biosynthesis
  Amino acid ligase
   BN117_0934 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp TTL ATPgrasp_ST ATPgrasp_YheCD ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 13888970
NCBI-ProteinID: YP_006894943
UniProt: K0ME19
Position
1023109..1024071
Genome map
AA seq 320 aa AA seqDB search
MSKQFGKVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFER
VFIALHGRYGEDGTLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAFEVL
GGSTELRLVPDRLGLPLILKPPHEGSTVGITKVAGYSDMKAAYELAARFDAEVLAEQFIT
GRELTVAVLGSGAAARALPVIEIVAPGGNYDYEHKYFSDDTQYFCPADLPADLPADVAAD
VAAVAERAYAALGCEGWGRVDFILDRENRPWLLEMNTSPGMTGHSLVPMAARAVGMSYAD
LCVAILAEAACKVRSPARQD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaattcggcaaagtcggcgtgttgtacggcggccgttcggccgagcgggaa
gtgtcgctgatgtccggcaagggcgtgcacgaagccctgctgagcgccggcgtggacgcg
cacctgttcgacaccggcgagcgcagcctggcggacctcgccgcggcgggtttcgagcgc
gtgttcatcgccctgcatggccgctatggcgaggacggcacgctgcagggagcgctggag
ctgttgggcattccttacaccggcagcgggccgctggcttcaagcctgtcgatggacaag
atcatgaccaagcgggtgtggctgcagcacggcttgcccacgccggccttcgaggtgctg
ggcggcagcaccgaactgcgcctggtgcccgaccgcctgggcctgccgctgatactcaag
ccgccgcacgagggctcgaccgtcggcatcaccaaggtggcgggctattcggacatgaag
gcggcgtacgagctggctgcgcgtttcgacgccgaggtgctggccgaacagttcatcacg
ggccgcgaactgaccgtcgccgtgctgggctcgggcgccgcggcgcgcgccttgccggtg
atcgagatcgtcgcgcctggcggcaattacgactacgaacacaagtacttctcggacgac
acgcagtacttctgcccggccgacctgcccgcggacctgcccgcggacgtggccgcggac
gtggccgccgtcgccgagcgcgcctacgccgcgctaggttgcgagggttggggccgggtc
gacttcatcctggaccgggagaaccggccctggctgctggaaatgaatacttcgcccggc
atgaccggccattcactggtgccgatggcggcgcgcgcggtgggcatgagctatgccgac
ctgtgcgtggccatcctggccgaggccgcgtgcaaagtgcgcagcccggcgcgacaagat
tga

DBGET integrated database retrieval system