KEGG   Bordetella parapertussis Bpp5: BN117_1030Help
Entry
BN117_1030        CDS       T02297                                 

Definition
(RefSeq) carnitinyl-CoA dehydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00071  Fatty acid degradation
bpar00280  Valine, leucine and isoleucine degradation
bpar00281  Geraniol degradation
bpar00310  Lysine degradation
bpar00360  Phenylalanine metabolism
bpar00362  Benzoate degradation
bpar00380  Tryptophan metabolism
bpar00410  beta-Alanine metabolism
bpar00627  Aminobenzoate degradation
bpar00640  Propanoate metabolism
bpar00650  Butanoate metabolism
bpar00903  Limonene and pinene degradation
bpar00930  Caprolactam degradation
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01120  Microbial metabolism in diverse environments
bpar01130  Biosynthesis of antibiotics
bpar01212  Fatty acid metabolism
Module
bpar_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN117_1030
   00650 Butanoate metabolism
    BN117_1030
  Lipid metabolism
   00071 Fatty acid degradation
    BN117_1030
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN117_1030
   00310 Lysine degradation
    BN117_1030
   00360 Phenylalanine metabolism
    BN117_1030
   00380 Tryptophan metabolism
    BN117_1030
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN117_1030
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN117_1030
   00281 Geraniol degradation
    BN117_1030
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN117_1030
   00627 Aminobenzoate degradation
    BN117_1030
   00930 Caprolactam degradation
    BN117_1030
Enzymes [BR:bpar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN117_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 13889066
NCBI-ProteinID: YP_006895037
UniProt: K0MFA7
Position
1128033..1128800
Genome map
AA seq 255 aa AA seqDB search
MSELVKVEIADGIQIITVNRPEARNAINFETAQAMAAALDQLDERDDVRIGILTGAGGTF
SAGMDLKAFARTGQRPSLPERGFAALTERPPKKPLIAAVEGYALAGGCEMALSCDLLVAA
DNAKFGLPEVKRGLVPGAGGMLRLPRRLPYHIAMEIILTGDFLDASRAHALGLVNRLTAA
GGALEGALALARVIVENGPLAVQVAKSIVAQSGDWDQETMFDRQRPQVTEIFTSADAKEG
ATAFAEKRKPVWQGK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaactggtcaaggtggaaatcgccgacggcatccagatcatcacggtcaaccgt
cccgaagccaggaacgccatcaatttcgaaacggcgcaggccatggccgccgcgctggac
caactcgatgagcgcgacgacgtgcgtatcggcatcctgaccggcgcgggcggcacgttc
tcggccggcatggacttgaaggcgttcgcccggaccggacagcgcccgtcgctacccgag
cgtggctttgccgccctgaccgaacgcccgccgaagaaaccgctgatcgcggcggtcgag
ggctatgcgctggccggtggctgcgaaatggccctgagctgcgatctgctggtggccgcc
gacaatgccaagttcggcctgcccgaagtcaagcgcggcctggtgccgggcgccggcggc
atgctgcgcctgccgcgccggctgccgtaccacatcgccatggaaatcatcctgacgggc
gatttcctggatgcgtcgcgcgcccatgcgctgggcctggtcaaccgcctgacggcggcc
ggcggcgcgctggaaggcgcgctggcgctggcccgcgtcatcgtcgagaacggcccgctg
gcggtgcaggttgccaagagcatcgtcgcgcaatcgggcgactgggaccaggaaaccatg
ttcgaccgccagcgtccgcaggtcaccgaaatcttcacctcggccgacgccaaggaaggc
gccaccgccttcgccgagaagcgcaagcctgtctggcaaggcaaataa

DBGET integrated database retrieval system