KEGG   Bordetella parapertussis Bpp5: BN117_1329Help
Entry
BN117_1329        CDS       T02297                                 

Definition
(RefSeq) carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00620  Pyruvate metabolism
bpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN117_1329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpar02000]
    BN117_1329
Enzymes [BR:bpar01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BN117_1329
Transporters [BR:bpar02000]
 Other transporters
  Primary active transporters [TC:3]
   BN117_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-GeneID: 13889365
NCBI-ProteinID: YP_006895314
UniProt: K0MBP8
Position
1451438..1452892
Genome map
AA seq 484 aa AA seqDB search
MSRRIGIIDTTLRDAQQCLWATRMTAGMMDPIAQALDEAGFDMIDFMAPVQFDVCVRYLR
EDPFEKARHFRKRFRNTPMRSYCRSKSLVGFSMVPDDMVELWIDCLAANGFSAVGTLDSL
LDVDNMKVSVRRAKKIGIKSIGALVFCESPLHTDALYAGTAAELVRCGVDGIMLKDSGAL
LTIERIRTLIPALRAAVGDIPIEVHSHSNTGLVQRVYLNAADLGIDQLHTSIAPLAGGVA
QPSIQNMTRNLAQRGYRTDVDMARVEEISAYLHRLAARYDFPLGKPMEYDEFHYRHQMPG
GMTENWRFQLRQAGLENRFEEILEEIGRVREDLAWPIMVTPFSQIIGVQAMLNVVNGERY
RAVPDEVKMYALGHFGRLLGPVEPNALDRIVANGSPDVGLTPQPKDPALPGLRKANPGMT
DEELLLRYMFSADDVEATLGCKPLKLTVPAGGPIVRLIEEILPRAGIRHFELRSQSEHIS
FTRP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccgcataggaatcatcgacacgacgctgcgcgacgcccagcaatgcctgtgg
gcgacgcggatgacggccggcatgatggacccgatcgcccaggcgctggacgaggcgggg
ttcgacatgatcgatttcatggccccggtgcagttcgatgtgtgcgtgcgctacctgcgc
gaagacccgttcgagaaggcgcgccacttccgcaagcgctttcgcaacacgcccatgcgc
agctattgccgcagcaagagcctggtcgggttcagcatggtgcccgacgacatggtcgag
ctgtggatcgattgcctggcggccaacggcttcagcgcggtcggtacgctcgattcgctg
ctggacgtcgacaacatgaaagtcagcgtccggcgcgccaagaagatcggcatcaagtcg
atcggcgcgctggtgttctgcgaaagccccctgcataccgacgcgctgtatgccggcacg
gccgccgagctggtgcgctgcggggtggacggcatcatgctcaaggactccggcgccctg
ctgacgatcgagcgcatccgcacgctcatcccggcgctgcgcgccgccgtcggcgacatc
ccgatcgaggtgcacagccacagcaataccggcctggtccagcgcgtctacctaaacgcg
gccgacctgggcatcgaccagctgcatacctcgatcgcgccgctggccggcggggtggcg
cagccctccatccagaacatgacgcgcaatctcgcgcagcgcggctaccgcaccgacgtg
gacatggcgcgcgtcgaggagatcagcgcctatctgcaccggctggcggcccgctacgac
ttcccgctgggcaagccgatggaatacgacgaattccattatcggcaccagatgccgggc
ggcatgacggagaactggcgcttccagttgcgccaggcggggctggagaaccgcttcgag
gaaatcctcgaagagatcggccgcgtgcgcgaggacctggcctggccgatcatggtgacg
ccgttctcgcagatcatcggcgtgcaggccatgctcaacgtggtcaacggcgagcgctac
cgcgccgtgcccgacgaagtgaagatgtacgcgctgggccacttcggcaggctgctgggg
ccggtcgaacccaacgccctggaccgcatcgtcgccaacggctcgcccgatgtcggcctg
acgccgcaaccgaaggaccccgccttgccggggctgcgcaaggccaatcccggcatgacc
gacgaagaactgctgctgcgctacatgttctcggccgacgacgtcgaggcgacgctgggc
tgcaagccgctgaagctgaccgttcccgccggcgggccgatcgtcaggctgatcgaggaa
atcctgccgcgcgccggcatacgccatttcgaattgcgcagccagtccgaacacatttcg
ttcacgcgaccctga

DBGET integrated database retrieval system