KEGG   Bordetella parapertussis Bpp5: BN117_1542Help
Entry
BN117_1542        CDS       T02297                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN117_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 13889578
NCBI-ProteinID: YP_006895511
UniProt: K0MFS6
Position
1675375..1675785
Genome map
AA seq 136 aa AA seqDB search
MNAGLAWRAGALCLALAASAAARAAAPDPVRGEQVYARCLACHALPYDRVGPRHCGLLGR
KAGSVPGFAYTQAMEDSGLTWDATTLDRFLADPLKTVPGTAMTYAGVPDAGERADLIAYL
RAAAASPACAGVATPH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgggcctggcctggcgggccggcgcgctgtgcctggccctggctgcgtcggcg
gccgcgcgggccgcagcgcccgacccggtgcgcggcgagcaggtctacgcgcgctgcctg
gcctgccacgcgctgccctacgaccgggtggggccgcgccactgcggcctgctcgggcgc
aaggccggcagcgtgcccggcttcgcctatacgcaagccatggaagactccggcctgacc
tgggacgccaccacgctcgaccgcttcctggccgatcccttgaagacggtgccaggcacc
gccatgacttacgcgggcgtgccggatgcgggcgagcgcgccgacctcatcgcctacttg
cgcgcggccgccgcctcgccggcgtgcgcgggcgtggccacgccacattag

DBGET integrated database retrieval system