KEGG   Bordetella parapertussis Bpp5: BN117_1812Help
Entry
BN117_1812        CDS       T02297                                 

Definition
(RefSeq) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bpar  Bordetella parapertussis Bpp5
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN117_1812
Enzymes [BR:bpar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BN117_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 13889849
NCBI-ProteinID: YP_006895764
UniProt: K0M8V5
Position
1973177..1974007
Genome map
AA seq 276 aa AA seqDB search
MTGDPRTDTTPSCRVAAIQMVSGPDVDENLAQAAELIGKAAQGGARLVALPEYFCFMGHT
DTDKLAIKEESGYGKIQSFLSNISSQYGIWVAGGTLPLTSPDPQRVFNTTFVYGPGGQPA
ARYDKIHLFNFQRGAESYDEAIAIRPGKEVQVFDGPCGRVGLSVCYDLRFPELYRAMGTV
DLILVPAAFTYTTGQAHWELLLRARAIENQCYVLAPAQGGRHPTGRRTWGHSMLVDPWGQ
VLDVLPEGPGVIGGTIEAARLAEVRASLPALRHRVL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgaccctcgaaccgacacaaccccgtcctgccgcgtggcggccatacagatg
gtctccggccctgacgttgatgaaaacctggcgcaagctgctgaattgattgggaaagcc
gcgcaaggcggtgcgcggctggttgcgttgcccgaatatttctgttttatggggcatacc
gataccgacaaacttgccatcaaggaagagagtggttatggcaaaattcagagctttctt
tcaaatatttcatcccaatatggaatatgggtggcgggcggtaccttgccattaaccagc
ccggacccgcagcgcgtattcaatacaacttttgtatacggacccggcggccagccggcg
gcgcgctacgacaaaatccatttattcaatttccagcgcggcgccgaatcgtatgacgag
gcaattgccatccggcccggcaaagaggtgcaggtattcgatggcccgtgcgggcgggtc
ggattgtcggtgtgctacgacctgcgctttcccgagctgtaccgtgccatgggtacggtc
gacctgatcctggtgccggccgccttcacctacaccacgggccaggctcactgggagctc
ctgctgcgtgcccgcgccatcgaaaaccagtgttatgtgctggcgccggcgcaaggcggg
cggcatccgaccggacggcgcacctggggccattccatgctggtcgacccctgggggcag
gtgctggacgttttacccgaggggccgggcgtcatcggcggtaccatagaggctgcgcgc
ctggctgaggtacgcgccagcctgcctgccctgcgtcatcgcgttctatag

DBGET integrated database retrieval system