KEGG   Bordetella parapertussis Bpp5: BN117_2621Help
Entry
BN117_2621        CDS       T02297                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00480  Glutathione metabolism
bpar00590  Arachidonic acid metabolism
bpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BN117_2621
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN117_2621
Enzymes [BR:bpar01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BN117_2621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 13890658
NCBI-ProteinID: YP_006896480
UniProt: K0MEV0
Position
2811302..2811802
Genome map
AA seq 166 aa AA seqDB search
MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGLEELYRSYRNEGFVVL
GFPCNQFGRQEPGDEAAIAQFCETQYAISFPLFAKIDVNGAHAHPLYRWLKARKPGLLGT
RAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACAAPGPTP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatgtacgacttcagcgcccccaccataacgggcgcggaacgcgcgctggcc
gattttcgcggccaggtggcgctggtggtcaatgtcgcctcgcgctgcgggttcacgccc
cagtactcgggcctggaagaactgtaccgctcgtaccgcaacgaaggctttgtcgtcctg
ggatttccgtgcaaccagttcgggcgccaggagccgggcgacgaggccgccattgcgcag
ttctgcgaaacccagtacgccatcagcttcccgctgttcgccaagatcgacgtcaacggc
gcccacgcccacccgctgtaccgctggctgaaggcacgcaagcccggcctgctgggcacc
cgcgccatcaaatggaatttcaccaaattcctggtcgggcgcgacggcctgccgctgcgg
cgctacgcgcccgcccacacgcccgaatcgctgcgccacgacatcgcgcgcgcctgcgcc
gcgcccggcccgacgccctag

DBGET integrated database retrieval system