KEGG   Bordetella parapertussis Bpp5: BN117_3180Help
Entry
BN117_3180        CDS       T02297                                 

Gene name
odhB
Definition
(RefSeq) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00020  Citrate cycle (TCA cycle)
bpar00310  Lysine degradation
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01120  Microbial metabolism in diverse environments
bpar01130  Biosynthesis of antibiotics
bpar01200  Carbon metabolism
Module
bpar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN117_3180 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BN117_3180 (odhB)
Enzymes [BR:bpar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN117_3180 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 13891217
NCBI-ProteinID: YP_006896991
UniProt: K0MGD7
Position
complement(3427617..3428834)
Genome map
AA seq 405 aa AA seqDB search
MAITDVLVPQLSESVSEATLLTWKKQAGAAVEADEILIEIETDKVVLEVPAPSSGVLSEI
VMGDGSTVTSGEVIARIDTAAKAAAAPAAAAEAPAAAAAAPAAAAPAAASSAASGVASPA
AAKILAEKGVDAASVAGTGRDGRVTKGDALAAGNAPAAKAAAPVAPPTLSLDGRPEQRVP
MSRLRARIAERLLQSQAENAILTTFNEVNMQAVMDLRARYKDKFEKEHGVKLGFMSFFVK
VAVAALKKYPVLNASVDGKDIIYHGYFDIGIAVGTPRGLVVPILRNADQLTIAEIEKTIA
DFGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQAAILGIHATKERPVVENG
QIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgttctcgtccctcaactgtccgaatcggtttcggaagccacgctg
ctgacctggaagaagcaggcgggcgccgcggtcgaggccgacgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgccggccccgtcgtcgggcgtgctgtccgaaatc
gtcatgggtgacggcagcaccgtgacctcgggcgaagtcattgcccgcatcgacacggcc
gccaaggctgctgcggcgcctgccgccgctgccgaagcgcccgccgccgctgctgctgcg
ccggccgccgccgcgccggcggcggccagcagcgccgccagcggcgtggcctcgccggcc
gccgccaagatcctcgccgagaagggcgtggacgccgccagcgtggccggcaccggccgc
gacggccgcgtcaccaagggcgacgccctggccgcgggcaacgcgcccgccgccaaggcc
gccgcgccggtggcgccgcccacgctgtcgctggacggccgccccgagcagcgcgtgccg
atgagccgcctgcgcgcccgcatcgccgagcgcctgctgcaatcgcaagccgagaacgcc
atcctgacgacgttcaacgaagtcaacatgcaggccgtgatggacctgcgcgcccgctac
aaggacaagttcgagaaagagcacggcgtcaagctgggcttcatgtcgttcttcgtcaag
gtcgccgtcgccgcgctgaagaagtacccggtgctcaacgcctcggtcgacggcaaggac
atcatctaccacggctacttcgacatcggcatcgccgtcggcaccccgcgtggcctggtg
gtgcccatcctgcgcaacgccgaccagctgaccatcgccgaaatcgagaagaccatcgcc
gacttcggcaagcgcgccgcggacggcaagctgggcatcgaggaaatgaccggcggcacg
ttctcgatctccaacggcggggtgttcggctcgatgctgtccacgcccatcatcaacccg
ccgcaggcggccatcctgggcatccacgccaccaaggagcgcccggtggtcgagaacggc
cagatcgtcatccggccgatcaactacctggccatgtcctatgaccaccgcatcatcgac
ggccgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaagacccgcaacgc
ctgttgctggatctgtaa

DBGET integrated database retrieval system