KEGG   Bordetella parapertussis Bpp5: BN117_3323Help
Entry
BN117_3323        CDS       T02297                                 

Gene name
risA
Definition
(RefSeq) response regulator protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN117_3323 (risA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bpar02022]
    BN117_3323 (risA)
Two-component system [BR:bpar02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BN117_3323 (risA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 13891360
NCBI-ProteinID: YP_006897132
UniProt: K0MLC2
Position
3581662..3582396
Genome map
AA seq 244 aa AA seqDB search
MNTQNTTPIRKILVVDDDPRLRDLLRRYLSEQGFNVFVAEDAKEMGKLWQREHFDLLVLD
LMLPGEDGLSICRRLRGGHDNTPIIMLTAKAEEIDRIVGLEMGADDYLSKPFNPRELLAR
INAILRRRGTEEHPGAPSQENESIAFGPYVLNLSTRTLTRNGEQVPITTGEFSVLKVFAR
HPKIPLSRDKLMELARGREYEAFDRSLDVQISRLRKLIEPNPSKPVFIQTVWGLGYVFVP
DGGS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcaaaacaccactcctatccgcaagatcctggtcgtcgacgatgatccccga
ctgcgcgatctcctgcgccgctatctgtcggaacaagggttcaatgtattcgtggccgaa
gatgccaaggaaatgggcaaactgtggcaacgcgaacactttgacctgctggttctcgac
ctgatgctgccgggcgaggatggcctgtcgatctgccgccgcctgcgcggcggccacgac
aatactcccatcatcatgctgaccgccaaggccgaggaaatcgaccggatcgtcggcctg
gaaatgggagccgacgattacctgtccaagcccttcaacccgcgcgaactgctggcccgc
atcaatgcgatcctgcgccgccgcggcaccgaagagcacccgggcgcgcccagccaggaa
aacgagtcgatcgccttcggcccgtacgtcctgaacctgtccacgcgcaccctcacccgc
aatggcgagcaggtgccgatcacgaccggcgaattctcggtcctgaaggtttttgcccgc
catcccaagatcccgctgtcgcgcgacaagctgatggaactggcccgcggacgcgaatac
gaggcgttcgaccgcagcctggatgtgcagatttcgcgtctgcgcaaattgatcgaaccc
aacccgtccaaacccgttttcatccaaaccgtctggggcctgggatacgttttcgttccg
gatggcggcagttga

DBGET integrated database retrieval system