KEGG   Butyrivibrio proteoclasticus: bpr_I0712Help
Entry
bpr_I0712         CDS       T01292                                 

Gene name
asnB6
Definition
(GenBank) asparagine synthase glutamine-hydrolyzing AsnB6
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00250  Alanine, aspartate and glutamate metabolism
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bpr_I0712 (asnB6)
Enzymes [BR:bpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     bpr_I0712 (asnB6)
Peptidases [BR:bpb01002]
 Cysteine Peptidases
  Family C44
   bpr_I0712 (asnB6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 DUF1933 NAD_synthase QueC
Motif
Other DBs
NCBI-ProteinID: ADL33455
UniProt: E0S0Y0
Position
1:858723..860585
Genome map
AA seq 620 aa AA seqDB search
MCGINGIFQFRRKFEIDKLSNYIGIMNQSIVHRGPDGEGVYVDETCALGMRRLSIIDLEK
GDQPIWNDDRTKAIIFNGEIYNYQELRNNLLGKGIGFSTNSDTEVILKGIESEGISFINR
LEGMFAFAIYDKKQQTVLLARDRLGEKPLYYAEDDGVLYFASELKSILSIGVIKKQINTI
AFSQYLHLSYIPSPLTIIEGVYKLRPGYWMNMNSFGKTETIQYWDEHIDPKTIITDYDLG
KELLRKSVEESVKKCMVADVPVGVFLSGGIDSGIVAGLMAQYSAKPISTFTLGFSEKEYD
ESKRAEIIVQKYKTDHHIKVVKSEDVFEALPTVIESMGEPFADQSIIVTYILSAFTRKYV
KAVLTGDGGDELFAGYNRYLIEYYSQKYNEMPDPVKKMSDLVLRNIDGRTRLSRKVSKVI
DNANLPLDVQRLNLMCLAFNKSTILGKDSEEIYRDIRNCYEKYIGVTDEINRILYTDLKV
SLEGDMLAKVDRASMLASLETRVPLLGKNVVETSFMMPGTFKIAGRQQKKIFKEAFEDII
PNELRKKSKRGFDVPISKWIRNDLRTDMEKTISGGYAISEGMISKSAVNEMITRHISGYK
NYSMELWSLYVFEKWYVRNI
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaataaacggaatatttcaattcagaagaaaatttgaaatagataaactatcg
aactatataggaataatgaatcagagcatagttcacagaggaccagacggtgagggtgta
tatgttgatgaaacatgtgctctggggatgagaaggctttccataattgatctggaaaag
ggcgatcagcctatttggaatgacgatagaacaaaagcgattatttttaatggagaaata
tataactaccaagaattaagaaacaatctattgggaaaaggtattggtttcagtactaat
agtgatacagaagtaatattaaagggaattgagagtgaaggaattagttttatcaacaga
ctagaagggatgtttgcttttgctatatatgataaaaagcaacagactgttttgctggcg
agagaccgattgggagaaaagcccttatattatgctgaagatgatggggtattatatttt
gcatcagaactgaaaagtatactttcgataggtgtaataaaaaaacagataaatacgata
gctttttcgcagtatctgcatctttcatatataccatccccactaacaattattgagggt
gtgtataaattacgcccaggatattggatgaatatgaattcatttgggaaaacagaaacc
attcaatattgggatgagcacatagatcctaaaacaataattactgattacgaccttgga
aaagaactgctcagaaaatcggtagaggaatctgtaaaaaaatgcatggttgcagatgtc
cctgtaggtgtttttctttctggagggatagattctggaatagttgcaggattaatggca
cagtatagcgcgaaacctattagtacttttacattaggttttagcgaaaaggaatatgat
gaaagtaaacgagcagaaataatagttcagaaatataaaactgatcatcatataaaagtt
gttaaaagtgaagatgtatttgaggctttaccaacagtcatagaaagcatgggtgaaccc
tttgctgatcaatcaataatagtgacatatattttgtctgcctttactaggaaatatgtc
aaagcagttttgactggtgatggaggagatgaactatttgctggctataacagatatctt
attgagtattattcccaaaaatataacgagatgccagatccagtaaagaagatgtctgat
ttagttcttcgaaacatagatggaaggacaagattgtcaagaaaagtgtcgaaagtcata
gacaatgctaatcttcctttggatgtacaaagattaaatctgatgtgtttggcttttaac
aaatctacgatactaggtaaggatagcgaagaaatatatagagatatcaggaattgctat
gaaaagtatattggcgtgacagatgaaataaatcgcattctgtatacagacttaaaagtg
tctttggaaggtgatatgctggcgaaagtagacagggcttcgatgttggcttcgctggaa
acaagagtgcctttgttggggaagaatgttgttgaaacctcattcatgatgcctggaaca
tttaaaatcgctggtagacagcagaaaaaaatctttaaagaagcctttgaagatattatt
cctaatgagcttagaaagaaatctaaacgaggctttgatgttcctataagtaaatggata
agaaatgacttaagaacggatatggaaaaaaccataagtggtggatatgcgataagtgaa
gggatgatcagcaagtctgctgtaaacgaaatgataactcggcatatcagtggttataag
aactatagcatggagttgtggagcttgtatgtttttgagaagtggtatgtgagaaatata
tga

DBGET integrated database retrieval system