KEGG   Butyrivibrio proteoclasticus: bpr_I1685Help
Entry
bpr_I1685         CDS       T01292                                 

Gene name
bgl1A
Definition
(GenBank) beta-glucosidase Bgl1A
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00460  Cyanoamino acid metabolism
bpb00500  Starch and sucrose metabolism
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bpr_I1685 (bgl1A)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    bpr_I1685 (bgl1A)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     bpr_I1685 (bgl1A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Glyco_hydro_42 Cellulase Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: ADL34422
UniProt: E0RXJ5
Position
1:complement(2070755..2072059)
Genome map
AA seq 434 aa AA seqDB search
MNKFENGFMLGASTAAHQVEGNNTNSDYWLMENMEYSQFVEPSLDAVDHYNRYEEDIKML
ADAGLNTYRFSVEWARIEPEQGKFDEKEIEHYRKMIKCCRDNGVEPVITLMHFTSPVWLI
KLGGWDNEQVVELFANYARFVTEQLGSEIKYICTINEANMRLQIGALMERFKKQMMAKMA
NAAKSSGDSMEGQVQVGLNLSDPMEKMKLAAMENAKVFGDPQPHTFVSATDANGDMIVIK
AHQAAKEAIKAVNPDIQVGITLSLHDCQYIEGGKERADSDWNEEFSHYIPYIKDDDFFGL
QNYTRTTYGPDGIVPVPEGTPMTQMDYEVYPEALEHVIRRVHEEMPNVPIMVTENGIATA
DDKQRVEFIDKAIEGVQSCINDGIPVIGYCHWSLIDNFEWQKGYALTFGLCAVDRKTQIR
APKPSLKHLGGYLK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttcgagaacggatttatgctgggcgcttctactgcagcccaccaggttgaa
ggaaacaatacaaattcagattactggttgatggagaatatggagtattcccagtttgtt
gagccatcgctggatgctgttgaccattacaacagatatgaagaagacatcaagatgctt
gcggatgcaggccttaacacttacagattctctgttgaatgggcgcgtattgagcctgag
cagggcaagtttgatgaaaaggagatcgagcattacaggaagatgatcaaatgctgcagg
gacaatggtgttgagccggttattaccctcatgcatttcacatcacctgtgtggcttata
aaactgggaggctgggacaatgagcaggttgtagagctttttgccaactatgcaaggttc
gtcacagagcagcttggaagcgagataaagtatatctgcaccataaatgaggccaacatg
agacttcagataggcgctctcatggagagatttaagaagcagatgatggcgaaaatggca
aatgcagccaaaagcagcggtgactccatggagggacaggttcaggttggacttaatctc
tctgacccgatggagaaaatgaagctggcagcaatggagaatgccaaagtattcggagat
cctcaaccgcatacatttgtttctgcaacagatgcaaatggcgatatgatagttataaag
gcgcatcaggcagccaaggaagcaatcaaggctgttaatccggatattcaggttggtatt
acgctttccctgcacgactgccagtacatagaaggtggcaaggagcgcgcagacagcgac
tggaatgaggagtttagccattacattccttatatcaaggatgatgatttctttggactt
cagaattatacaagaactacttacggcccagatggaattgtgcctgtccccgagggaaca
ccaatgacacagatggattatgaagtatatcctgaggctcttgagcatgtaataagacgc
gtgcatgaggagatgccaaatgttccgatcatggttaccgaaaatggaatagcaacagca
gatgataagcagagagttgagtttatcgacaaggcaattgagggtgttcagagctgtata
aatgatggaattcctgtcatcggatactgccactggtcacttatcgataattttgagtgg
cagaaaggttatgcgctgacatttggtctttgcgcagttgacaggaaaacacagatcagg
gcaccaaagcctagtttgaagcatcttggaggctatttgaaataa

DBGET integrated database retrieval system