KEGG   Butyrivibrio proteoclasticus: bpr_I1865Help
Entry
bpr_I1865         CDS       T01292                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase MurD
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00471  D-Glutamine and D-glutamate metabolism
bpb00550  Peptidoglycan biosynthesis
bpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    bpr_I1865 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    bpr_I1865 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpb01011]
    bpr_I1865 (murD)
Enzymes [BR:bpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     bpr_I1865 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:bpb01011]
 Precursor biosynthesis
  Amino acid ligase
   bpr_I1865 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADL34599
UniProt: E0RWS3
Position
1:complement(2280222..2281595)
Genome map
AA seq 457 aa AA seqDB search
MTADLKGKKVLVIGSGLSGVGSVNLLNKVGALPVVLEENTKVTEDNIRNKLHEEDREGTR
IIVGTISDEDLSDIALTVPSPAVPLDAPTVMRIKDKNIPIWSEIELAYNFAKGKMIAITG
TNGKTTTTTLVGEIMKAHFGKAYVVGNIGVSYAESALEMDESCVTVGEISSFQLEAVDNF
HANVSAILNITPDHLNRHHTMECYAQMKENITHNQTKEDTCVLNYDNEYTRDFGARCPAK
VVFFSSKEKLEDGFYLDGEDIYMATAGNAMKIMNIHDMNLVGTCNVENVMAAIAMSLAMD
VPLATILSVIRNFKAVEHRIEFVATKRGVDYYNDSKGTNPDAAIQGVKAMCKPTILIGGG
YDKGNDYDEWIESFGDTIKLLVLIGQTRQKIAECCDKHGFSNYVFKDTYEEALEFCTESA
QKGDAVLLSPACASWDMFPNYETRGKRFKDYVNKLSD
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagatttaaaagggaaaaaagttcttgtaatcggctcgggactttcaggagtt
ggatcagtaaaccttctcaataaggttggtgcgcttcctgtagtacttgaggaaaatacc
aaggttacagaggataacatcagaaataagttacatgaagaagatagagagggtaccagg
ataatagttgggacaatctctgacgaagatctttcagatatagctctgacagtgccaagt
cctgcagttccacttgatgctccgacagttatgcgtatcaaggataagaatattccaatc
tggagtgagattgaacttgcctataactttgctaagggcaaaatgatcgcaatcacagga
acaaacggcaagactactactacaacacttgtaggtgagatcatgaaggcgcactttgga
aaagcgtacgtagtaggcaatataggtgtttcctatgctgagagcgcacttgaaatggat
gagtcttgcgtaacagtcggtgagataagctctttccagctcgaagcagtagataatttc
catgctaatgtatcagctattctcaatatcacaccggatcatcttaacagacatcatacg
atggaatgttatgctcagatgaaagagaatattacacataaccagaccaaagaggacact
tgcgttctcaactatgacaacgaatatacaagagattttggagctagatgtcctgccaag
gttgtattcttttcgtcaaaagaaaagcttgaagacggcttctatcttgatggcgaggat
atttacatggcaactgcaggaaatgccatgaagatcatgaatatacatgatatgaatctt
gttggaacctgtaatgttgagaatgtaatggcagctatagcaatgagccttgctatggat
gtgcctcttgctactattttgtctgttatcaggaatttcaaggccgttgaacacagaatt
gaatttgtagctaccaagagaggtgttgattactacaacgattctaagggaactaatccg
gatgcagcaattcagggcgttaaggctatgtgtaagcctacaatactcataggcggcgga
tatgataaaggaaatgactatgatgagtggattgagagctttggcgatactataaagctt
cttgtcctcattggacagaccaggcagaaaatagctgagtgttgtgacaaacacggcttt
agtaattacgtatttaaggatacttatgaagaggcacttgagttctgcactgagagcgca
cagaagggcgatgcggttcttttgtctcccgcatgcgcaagctgggacatgttcccaaat
tatgagaccagaggtaagagatttaaagattacgtaaataaattatctgactaa

DBGET integrated database retrieval system