KEGG   Butyrivibrio proteoclasticus: bpr_I2048Help
Entry
bpr_I2048         CDS       T01292                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00010  Glycolysis / Gluconeogenesis
bpb00051  Fructose and mannose metabolism
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01120  Microbial metabolism in diverse environments
bpb01130  Biosynthesis of antibiotics
bpb01200  Carbon metabolism
bpb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bpr_I2048 (tpiA)
   00051 Fructose and mannose metabolism
    bpr_I2048 (tpiA)
   00562 Inositol phosphate metabolism
    bpr_I2048 (tpiA)
Enzymes [BR:bpb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     bpr_I2048 (tpiA)
Exosome [BR:bpb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   bpr_I2048 (tpiA)
  Exosomal proteins of bladder cancer cells
   bpr_I2048 (tpiA)
  Exosomal proteins of melanoma cells
   bpr_I2048 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADL34782
UniProt: E0RYT7
Position
1:complement(2501915..2502661)
Genome map
AA seq 248 aa AA seqDB search
MARRRIIAGNWKMNKTPSEAVALCAELKDLVKNDAVDVVYCVPAIDIVPVVEAVKGTNVH
VGAENFYIEDKGAFTGEISAPMLKDAGVEYIIIGHSERRDIFGENDILINQKVKKAFASG
LKPILCCGESLALRKAGTYKEWIERQITWDLDGVTADQVKELVIAYEPIWAIGTGETATA
DQAEEVCALIRELICKLYDQATAEAVRIQYGGSMNAGNAAELLSKANIDGGLIGGASLKP
DFGQIVNA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagacgtattatcgccggtaactggaagatgaacaagactcccagcgaggct
gtagctctttgcgcagagctcaaagatttagttaagaatgatgctgtagacgtagtttac
tgcgtaccagcaattgatattgttcctgtagtagaggctgtaaagggcacaaatgtacat
gtaggtgctgagaacttctacattgaggacaagggagcattcacaggagaaatttcagct
cctatgctcaaggatgctggtgttgagtacatcatcatcggacattccgagagaagagat
atcttcggcgagaacgatattctcatcaaccagaaggttaagaaggcttttgcttcaggc
cttaagccaatcctttgctgtggcgagtcacttgcacttcgtaaggccggcacatacaag
gagtggattgagagacagatcacatgggatctcgatggcgtaacagcagatcaggttaag
gagcttgttattgcttacgagcctatctgggctatcggaacaggtgagacagctacagct
gatcaggctgaggaagtatgcgcacttatccgtgagcttatctgcaagctttatgatcag
gcaacagctgaagcagttcgtattcagtatggcggatcaatgaacgcaggaaacgcagca
gagcttctttccaaggctaacattgacggtggtcttatcggcggcgcaagccttaagcca
gatttcggccagatcgttaacgcgtaa

DBGET integrated database retrieval system