KEGG   Butyrivibrio proteoclasticus: bpr_I2475Help
Entry
bpr_I2475         CDS       T01292                                 

Gene name
thlA2
Definition
(GenBank) thiolase ThlA2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00071  Fatty acid degradation
bpb00280  Valine, leucine and isoleucine degradation
bpb00310  Lysine degradation
bpb00362  Benzoate degradation
bpb00380  Tryptophan metabolism
bpb00620  Pyruvate metabolism
bpb00630  Glyoxylate and dicarboxylate metabolism
bpb00640  Propanoate metabolism
bpb00650  Butanoate metabolism
bpb00900  Terpenoid backbone biosynthesis
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01120  Microbial metabolism in diverse environments
bpb01130  Biosynthesis of antibiotics
bpb01200  Carbon metabolism
bpb01212  Fatty acid metabolism
bpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bpr_I2475 (thlA2)
   00630 Glyoxylate and dicarboxylate metabolism
    bpr_I2475 (thlA2)
   00640 Propanoate metabolism
    bpr_I2475 (thlA2)
   00650 Butanoate metabolism
    bpr_I2475 (thlA2)
  Lipid metabolism
   00071 Fatty acid degradation
    bpr_I2475 (thlA2)
   00072 Synthesis and degradation of ketone bodies
    bpr_I2475 (thlA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bpr_I2475 (thlA2)
   00310 Lysine degradation
    bpr_I2475 (thlA2)
   00380 Tryptophan metabolism
    bpr_I2475 (thlA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bpr_I2475 (thlA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bpr_I2475 (thlA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    bpr_I2475 (thlA2)
Enzymes [BR:bpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bpr_I2475 (thlA2)
Exosome [BR:bpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bpr_I2475 (thlA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: ADL35208
UniProt: E0RVQ0
Position
1:complement(3027321..3028502)
Genome map
AA seq 393 aa AA seqDB search
MARKVVLAGACRTAIGTMGGTLSTTPAPALGAIVIREALKRAGVKPEQVDEVYMGCVIQA
GLGQNPARQSAINAGIPVEVPATTINVLCGSGLHCVNLAAKLIGMGDADIIVAGGMENMS
MAPYLMQQGRYGYRMGSGELQDAMIKDALTDAFGGYHMGITAENIAEQWHLTRQQLDEFA
AWSQNKAEKAIAEGKFKEEIVPVEIKKKKETIIFDTDEGPRKGVTVEGISGLKPAFKKDG
GVVTAANSSGINDAASAIIVMSEEKAKELGVKPLGTWIAGELAGVEPSIMGIGPVAATQK
VMKKAGYTIGDFDLIEANEAFAAQSVAVQHDLGFSNDVLNVNGGAIALGHPVGCSGNRIL
VSLLYEMQRRDVHKGLATLCVGGGMGCAAIVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaagtagttttagcaggagcatgcagaacagcaattggaacaatgggtgga
acactttcaacaactccggcaccggctcttggtgctattgttatcagggaagctttgaaa
agagcaggagttaagcctgagcaggttgatgaagtatatatgggatgtgttatccaggcg
ggtcttggacagaatcctgctagacagtcagctattaatgcaggaatccctgtagaagta
ccggcaacaacaatcaatgtactctgcggttcaggacttcattgcgtaaaccttgctgcc
aagctcattggaatgggcgatgctgatattatcgtagcaggcggtatggagaatatgtca
atggctccttatcttatgcagcagggccgttatggttacagaatgggttcgggtgagctt
caggatgctatgatcaaggatgctcttacagatgctttcggcggttatcatatgggtatc
actgctgagaatattgctgagcagtggcatcttacaaggcagcagcttgatgagtttgca
gcatggtcacagaacaaagctgaaaaggcaattgctgaaggcaaattcaaggaagaaatc
gttcctgtagaaatcaagaaaaagaaagaaactattatttttgatacagatgaaggcccg
agaaaaggtgtgactgtagagggaatttcaggtcttaagcctgcatttaagaaggacggc
ggtgtagttacagctgctaactcttcaggaattaacgatgcagcgtctgctatcatagtt
atgagtgaagaaaaggccaaagaacttggggttaagccacttggaacatggattgcagga
gaacttgcaggtgtagagccaagtattatgggtatcggacctgtagctgctactcagaag
gtaatgaagaaggccggatatacaatcggtgattttgatcttattgaagctaatgaagct
tttgcagctcagtctgtggctgtacagcatgatcttggctttagcaatgatgtacttaat
gttaacggtggtgctattgcgctcggacatcctgtaggatgctcaggaaacagaatatta
gtatctcttttgtatgaaatgcagagaagagatgtgcataaaggacttgctactctgtgc
gtaggtggcggaatgggatgtgctgctatagttgagagataa

DBGET integrated database retrieval system