KEGG   Butyrivibrio proteoclasticus: bpr_I2488Help
Entry
bpr_I2488         CDS       T01292                                 

Gene name
thlA1
Definition
(GenBank) thiolase ThlA1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00071  Fatty acid degradation
bpb00280  Valine, leucine and isoleucine degradation
bpb00310  Lysine degradation
bpb00362  Benzoate degradation
bpb00380  Tryptophan metabolism
bpb00620  Pyruvate metabolism
bpb00630  Glyoxylate and dicarboxylate metabolism
bpb00640  Propanoate metabolism
bpb00650  Butanoate metabolism
bpb00900  Terpenoid backbone biosynthesis
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01120  Microbial metabolism in diverse environments
bpb01130  Biosynthesis of antibiotics
bpb01200  Carbon metabolism
bpb01212  Fatty acid metabolism
bpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bpr_I2488 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    bpr_I2488 (thlA1)
   00640 Propanoate metabolism
    bpr_I2488 (thlA1)
   00650 Butanoate metabolism
    bpr_I2488 (thlA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    bpr_I2488 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    bpr_I2488 (thlA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bpr_I2488 (thlA1)
   00310 Lysine degradation
    bpr_I2488 (thlA1)
   00380 Tryptophan metabolism
    bpr_I2488 (thlA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bpr_I2488 (thlA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bpr_I2488 (thlA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bpr_I2488 (thlA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpb04147]
    bpr_I2488 (thlA1)
Enzymes [BR:bpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bpr_I2488 (thlA1)
Exosome [BR:bpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bpr_I2488 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD DUF1153 pXO2-72
Motif
Other DBs
NCBI-ProteinID: ADL35221
UniProt: E0RVR3
Position
1:complement(3041998..3043206)
Genome map
AA seq 402 aa AA seqDB search
MEENFMAQKVVIAGACRTAIGKMGGALSNTPAAELGSIVIKEALNRAGVKPEMVDEVLMG
CVIQAGLGQNVARQASIKAGLPIEIPAVTLNVVCGSGLNCVNMAADLIKAGEADIVVAGG
MENMSMAPYALPNARFGYRMNNGTVVDTMVNDALTDAFNHYHMMITAENICDRWNLTREE
LDEFSANSQQKCEKAMAEGRFNDEIVPVPVKVKKEMVEFKTDEGPRAGTTVETLSKLKCC
SGKEGGLVTAGNASGINDGAAAVVVMSEEKAKELGVKPMATWVGGALAGVEPEIMGIGPV
AATKKVLKKTGLSLDNIDLIEANEAFAAQSVAVAKDLGFDMSKVNVNGGAIALGHPVGAS
GCRILVTLLHEMAKREDAKKGLATLCIGGGMGCATIVERYEA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaactttatggcacagaaggtagttatagcaggtgcatgtagaacagctatc
ggtaagatgggcggagctctcagcaatactcctgcagcagaacttggttcaatcgtaatc
aaggaggcacttaacagagcaggtgttaaacctgagatggtagacgaggtacttatggga
tgcgttatccaggctggacttggacagaacgtagcaagacaggcttccatcaaggctggt
cttcctattgagattcctgcagtaacacttaacgtagtttgtggatctggtcttaactgt
gtcaacatggcagctgacctcatcaaagctggagaggctgacatcgtagttgccggtggt
atggagaacatgtcaatggctccttacgcacttcctaatgcacgttttggatatcgtatg
aacaacggaactgttgtagatacaatggttaacgatgctcttacagacgcttttaatcac
tatcacatgatgatcacagcagagaacatctgtgacagatggaaccttacaagagaggaa
ctcgatgagttctcagctaattctcagcagaagtgcgagaaggctatggctgaaggcaga
ttcaacgacgagatcgttcctgttccagttaaggttaagaaggaaatggttgagttcaag
acagatgagggccctcgtgccggaacaactgttgagactctttctaagcttaaatgctgc
tctggtaaagagggtggtcttgtaacagctggtaatgcatcaggtatcaatgatggtgct
gctgcagttgttgttatgagcgaagagaaggctaaagaacttggtgttaagcctatggct
acatgggttggcggcgctcttgcaggtgttgaacctgaaattatgggtatcggtcctgta
gctgctactaagaaagtactcaagaaaactggtctttcacttgataatatcgatcttatc
gaagctaacgaggcttttgcagcacagtcagttgcagttgctaaggaccttggctttgat
atgagcaaggttaacgtaaatggtggtgctatcgcacttggtcaccctgttggagcatca
ggatgccgtatccttgttactcttcttcatgagatggctaagagagaagatgccaagaag
ggtcttgctactctttgcatcggtggcggaatgggctgcgcaactatcgttgagcgttac
gaggcttaa

DBGET integrated database retrieval system