KEGG   Butyrivibrio proteoclasticus: bpr_I2854Help
Entry
bpr_I2854         CDS       T01292                                 

Gene name
pgl28B
Definition
(GenBank) polygalacturonase Pgl28B
Organism
bpb  Butyrivibrio proteoclasticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3 Beta_helix
Motif
Other DBs
NCBI-ProteinID: ADL35584
UniProt: E0S097
Position
1:3424335..3425894
Genome map
AA seq 519 aa AA seqDB search
MMDFDFLLDYRATDSEAEVFWDMPLDADLSCRYLCLINGSLYKEITKTHISLTDLTPDTA
LDVEIRIIYPEGHVNGSEPVCLGRITVRTGKVKRKIDVTTSPYNALGDGKTLNTAALQKA
LDDCDENSIVFFPKGTYLTGALNVHSNSEIYLEEGALLQGTEDPADYLPKIHSRFEGYEM
ECYRSLLNLGELDHSSGFNCENVIIRGEGSIMGGGAALAKSIARIEGERLRDYIASLGDK
IKEYEKPETIASRFRGRLINMSNCQNIWIHGLTLGFAPSWNIHFIYSDQIVTDHCTLKSE
GVWNGDGWDPDSSTNSTLYACDFYTEDDSVAIKSGKNPEGNVINRPTKHIRVFDSVTHFG
HGLCIGSEMSGGVEDVRLWDCQMGPTWSGIEIKATKKRGGYVRNILVRDITASHIQMHSV
GYNDDGEGSKVPPILGDCRFERMHLLGRYLDNNAGHNEWHDCPSILLCGFDVPGYEIKNV
EFKDIEMEEPAEGIEDIHIEYCTNITYENMKIVPRTECY
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgatggattttgattttctactggactatagagcaactgactctgaggctgaagtgttc
tgggatatgcctcttgacgctgatcttagctgcagatatctttgccttattaatggctct
ttatataaagaaataactaaaactcacatttctctcactgatcttactcctgacacagct
ctggacgtcgagatcaggatcatatatccggaaggacatgtaaatggctctgagcctgta
tgtcttggccgcattactgttcgaacaggtaaagtcaaaagaaaaatcgacgtaaccacg
tcaccttataatgccctaggcgatggcaaaacgctcaataccgctgcgcttcagaaggcc
cttgatgactgtgatgagaattcaattgtctttttcccaaaaggaacatatttaacaggc
gctcttaatgtccattcaaactcagaaatttacctggaggaaggagctcttttgcaggga
acagaagatcccgctgattatcttccaaagattcacagtcgctttgaaggctatgaaatg
gagtgctatagaagtttgctgaatttgggcgagcttgatcatagttcaggttttaactgt
gaaaatgtgatcatccgaggagaaggatccattatgggcggcggtgctgcgcttgccaag
tctattgcgagaatcgaaggtgaacgcctcagggactatattgcttctcttggagataag
ataaaagagtatgagaagccggaaactatcgccagcagattcagaggccgtctcatcaac
atgagtaactgtcagaatatctggatccatggtctgacacttggatttgcaccttcatgg
aatattcactttatttactcagaccagattgtaaccgatcactgcacattaaaatctgaa
ggagtatggaatggtgatggctgggacccggactcttctactaattcaacgctttatgcc
tgtgatttctatacagaggatgactctgtagccatcaaatcaggcaagaatcctgaggga
aatgtgataaacaggccaaccaaacacataagagtatttgacagcgttacacatttcgga
catggcctatgtattggaagtgaaatgtcaggtggtgttgaggacgtccgtttgtgggac
tgccaaatgggacctacgtggtcaggtattgagataaaggcaaccaagaaacgcggcggt
tatgtcagaaatatcctagtccgtgatatcactgcttcacatatacagatgcactctgtt
ggttataacgatgacggtgagggttccaaggttcctccaattcttggggattgcaggttt
gaacgaatgcacctgctgggaaggtaccttgacaacaatgcaggtcataacgaatggcat
gactgtccttcaatactcctgtgcggctttgatgttccgggatatgaaatcaaaaatgta
gaattcaaagatatagaaatggaagaacccgcagaaggaattgaggatatccatatagag
tattgcacaaacatcacatatgagaatatgaaaattgttccacgtactgaatgctactga

DBGET integrated database retrieval system