KEGG   Bordetella pertussis CS: BPTD_0499Help
Entry
BPTD_0499         CDS       T01846                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00330  Arginine and proline metabolism
bpc00360  Phenylalanine metabolism
bpc00380  Tryptophan metabolism
bpc00627  Aminobenzoate degradation
bpc00643  Styrene degradation
bpc01100  Metabolic pathways
bpc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BPTD_0499
   00360 Phenylalanine metabolism
    BPTD_0499
   00380 Tryptophan metabolism
    BPTD_0499
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BPTD_0499
   00643 Styrene degradation
    BPTD_0499
Enzymes [BR:bpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BPTD_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEE65962
Position
complement(522031..523458)
Genome map
AA seq 475 aa AA seqDB search
MGWESICAMTALQLRAELAAGHLSAREILQAHLEAIEHWNPTVNAIVTLDVEGARRRAAA
ADQAQARGEPLGLLHGLPVAHKDSFLTAGMRTTHGSPVFADFVPERSSLVVTRQQAAGAI
TLGKTNLPEFGAGSQTFNAVFGPTRNPYDPAMTAGGSSGGAAAALACRMVLLADGTDMGG
SLRNPASFCNVVGLRPSPGRVPMWPTAAPYNTLSVAGPMARTVADAALMLAALAGPDARD
PLTIDADPGLFLGALERDFAGTRVAYAPDWGGLPVDPAVGRVLQAQLPRWEELGCRVDQA
CPDFGQADSSFHALRGLAFAINQGETVRRHRDRVKDTVIWNTELGLNQSGAVLAQAERDR
AQLFERMHDFMQQYEFLIGPVSQVPPFSADQEYIQRIGDVEMRNYIDWMRSGYYLSLTGH
PAISVPCGFTETGLPIGIQIVGRYRDERGVLQLAHAFEQLTQCWRQAPALRAPAA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggaatcgatttgcgcaatgaccgcgctgcaactgcgggccgaactggcggcc
ggccatctgagcgcgcgcgagatcctgcaggcgcatctggaggccatcgaacattggaac
cccacggtcaacgccattgtcacgctggatgtcgaaggcgcgcgccggcgcgccgcggcg
gccgaccaggcgcaggcgcgcggcgagccgctggggttgctgcacggcctgcccgtggcg
cacaaggacagtttcctgaccgccggcatgcggacgacccatggttcgcccgtattcgcc
gatttcgtgcccgagcgcagcagcctggtggtgacgcgccagcaggccgccggcgccatc
acgctgggcaagaccaacctgccggagttcggcgccggttcgcagaccttcaatgcggtg
ttcggccccacccgcaatccctatgacccggccatgacggccggcggcagcagcggcggc
gcggccgccgcgctggcgtgccgcatggtgctcctggccgatggcaccgatatgggcggg
tcgctgcgcaatccggccagcttctgcaatgtggtgggcctgcgtccttcgccgggccgg
gtgccgatgtggccgacggccgcgccgtacaacaccctgagcgtggctggtccgatggcg
cgcaccgtggccgacgccgccctgatgctggcggcgctggccggccccgacgcgcgcgat
ccgctgaccatcgatgccgacccaggcctgttcctgggggcgctggaacgcgatttcgcc
ggcacgcgcgtggcgtacgcaccggactggggcggcctgccggtcgatccggccgtcggc
cgcgtgctgcaggcgcaactgccgcgctgggaagagctgggttgccgggtcgaccaggca
tgtccggacttcggccaggcggattcgtcgttccatgccttgcgcggcctggcctttgcc
atcaatcaaggcgagaccgtgcggcggcatcgcgaccgcgtcaaggacaccgtgatctgg
aacacggaactgggcctgaaccagagcggcgccgtgctggcgcaggccgagcgcgaccgc
gcgcagctgttcgagcgcatgcacgacttcatgcagcagtacgaattcctgatcgggccg
gtcagccaggtgccgcctttttccgccgaccaggagtacatccagcgcatcggcgacgtg
gagatgcgcaactacatcgattggatgcgttcgggctactacctgtcgttgaccggtcat
ccggcgatttcggtgccctgcggattcaccgagacgggcctgccgatagggatacagatc
gtgggccgctatcgcgacgaacgcggcgtactgcaactggcgcacgcgttcgagcaactg
acccagtgctggcgccaggcgccggcgctgcgcgcgccggccgcctga

DBGET integrated database retrieval system