KEGG   Bordetella pertussis CS: BPTD_0706Help
Entry
BPTD_0706         CDS       T01846                                 

Definition
(GenBank) hydrolase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00540  Lipopolysaccharide biosynthesis
bpc01100  Metabolic pathways
Module
bpc_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BPTD_0706
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bpc01005]
    BPTD_0706
Enzymes [BR:bpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     BPTD_0706
Lipopolysaccharide biosynthesis proteins [BR:bpc01005]
 Unusual sugar
  BPTD_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD_2 HAD Dimerisation Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AEE66152
Position
complement(737289..737897)
Genome map
AA seq 202 aa AA seqDB search
MTKNSPVSVPHPAEALVLARIPASVRERAAAVRLMVFDVDGVLTDGGLYYGEHGEMFKRF
HALDGHGLRLLMEGGLKVALITGRSGPIADRRAAELGIAEVLQGVRDKGGALSELAQRVG
VQLNQTGYMGDDIIDLPAMQRAGFAASVANAPGYVAQAAHWVSSQPGGQGAVRECCDLLL
AAQGRLGTFLGTPALLGPGAIQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaactctcctgtttccgtgccgcaccccgccgaagccctggtgctcgcccgc
atccccgcctcggtgcgcgaacgcgccgccgcggtgcgcctgatggttttcgacgtcgac
ggcgtgctgaccgatggcggcctgtactatggcgagcacggcgaaatgttcaagcgtttc
catgcgctggacggccatggcctgcggctgctgatggaaggcggcctgaaagtcgccctg
atcaccggccgctccggccccatcgccgaccggcgcgccgccgagctgggcatcgccgaa
gtgctgcaaggcgtgcgcgacaagggcggcgccctgagtgaacttgcccagcgcgtgggc
gtccaactcaaccagaccggctatatgggcgacgacatcatcgacctgcctgccatgcag
cgcgccggcttcgccgccagcgtcgccaatgcgccgggctacgtggcgcaagccgcccac
tgggtatccagccagccgggcggccagggcgcggtgcgcgaatgctgcgacctgctgctt
gccgcccagggccgcctgggcaccttcctgggcacgccggccctgctcgggcccggcgcc
atccagtaa

DBGET integrated database retrieval system