KEGG   Bordetella pertussis CS: BPTD_0938Help
Entry
BPTD_0938         CDS       T01846                                 

Gene name
ubiG
Definition
(GenBank) 3-demethylubiquinone-9 3-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00130  Ubiquinone and other terpenoid-quinone biosynthesis
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BPTD_0938 (ubiG)
Enzymes [BR:bpc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     BPTD_0938 (ubiG)
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     BPTD_0938 (ubiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Ubie_methyltran NodS CMAS PrmA MTS DREV Methyltransf_9 TehB TPMT ADH_zinc_N Methyltransf_32 MetW AdoMet_MTase
Motif
Other DBs
NCBI-ProteinID: AEE66362
Position
complement(1002469..1003194)
Genome map
AA seq 241 aa AA seqDB search
MTTATQSSAPGVNVDQAEVEKFSALAARWWDPESEFKPLHAINPLRLGWIQETAGSLSGK
RVLDMGCGGGILSESMAVAGAQVTGIDLAEKSLKIARLHGLESGVKVDYRAVPVEELAAE
QPGQYDVVTCMEMLEHVPDPASVVRACAALAKPGGWVFFSTLNRNPKSFLFAIVGAEYVL
RLLPRGTHSYDSFIKPSELATSARQAGLEPTGMRGMEYNPITQVYSLSANTSVNYLMSTR
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagccacccaatccagcgcccccggcgtcaacgtcgaccaagccgaggtcgag
aaattcagcgcgctggccgcccgctggtgggacccggaaagcgaattcaagccgctgcat
gccatcaacccgctgcgcctgggctggatccaggagaccgccggcagcctgagcggcaag
cgcgtgctggacatgggctgcggcggcggcatcctgtcggagagcatggccgtggccggc
gcgcaggtcaccggcatcgacctggccgagaaatcgctcaagatcgcccgcctgcacggg
ctggagtccggcgtgaaggtcgattaccgcgccgtgcccgtcgaggaactggccgccgag
cagccgggccagtacgacgtggtgacctgcatggaaatgctcgaacacgtgccggatccg
gcctccgtcgtgcgggcctgcgccgcgctggccaagcccggcggatgggtgttcttctcc
accctgaaccgcaaccccaagtcgttcctgttcgccatcgtcggcgccgaatacgttctg
cgcctgctgccgcgcggcacccacagctacgacagcttcatcaagcccagcgaactggcc
accagcgcgcgccaggccggcctggaacccacgggcatgcgcggcatggagtacaacccc
attacccaggtctattcgctgtcggccaacacctcggtcaactacctgatgtccacccgc
aaatga

DBGET integrated database retrieval system