KEGG   Bordetella pertussis CS: BPTD_2027Help
Entry
BPTD_2027         CDS       T01846                                 

Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00071  Fatty acid degradation
bpc00072  Synthesis and degradation of ketone bodies
bpc00280  Valine, leucine and isoleucine degradation
bpc00310  Lysine degradation
bpc00362  Benzoate degradation
bpc00380  Tryptophan metabolism
bpc00620  Pyruvate metabolism
bpc00630  Glyoxylate and dicarboxylate metabolism
bpc00640  Propanoate metabolism
bpc00650  Butanoate metabolism
bpc00900  Terpenoid backbone biosynthesis
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01120  Microbial metabolism in diverse environments
bpc01130  Biosynthesis of antibiotics
bpc01200  Carbon metabolism
bpc01212  Fatty acid metabolism
bpc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPTD_2027
   00630 Glyoxylate and dicarboxylate metabolism
    BPTD_2027
   00640 Propanoate metabolism
    BPTD_2027
   00650 Butanoate metabolism
    BPTD_2027
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BPTD_2027
   00072 Synthesis and degradation of ketone bodies
    BPTD_2027
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPTD_2027
   00310 Lysine degradation
    BPTD_2027
   00380 Tryptophan metabolism
    BPTD_2027
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPTD_2027
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPTD_2027
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BPTD_2027
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpc04147]
    BPTD_2027
Enzymes [BR:bpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BPTD_2027
Exosome [BR:bpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPTD_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEE67340
Position
2203354..2204541
Genome map
AA seq 395 aa AA seqDB search
MNEVVVVVVAAARTAIGDFGGGLKDVAPCDLGATVIREALARAGVAGPEVGHVAVGHVIN
TEPRDMYLSRVAAINAGIGKETPAFNVNRLCGSGLQAIVSAAQTIMLGDTEIAVGAGAES
MSRAPYIAPAQRWGARMGDSAMVDMMTGALSDPFGRMHMGVTAENVAARYSISRADQDAL
AVESHRRAAAAIDAGRFRDQIVPVTLKTRKGETVFDTDEHVRRDITIEGMAALRPVFQKE
NGTVTAGNASGLNDGAGAVVLMSAAAAAQRGIAPMARLVAYAHAGVDPEIMGIGPVPATQ
AALKRAGLTVDQLDVIEANEAFAAQACAVTRQLELDPAKVNPNGSGISLGHPIGATGAII
TVKALYELQRVGGRYALVTMCIGGGQGIAAIFERV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtcgtagtcgtagtcgtagccgctgcccgtaccgccattggcgatttcggc
ggcggcctgaaagacgtggcgccctgcgacctgggcgccacggtcatccgggaagcgctg
gcgcgcgccggcgtggccggccccgaggtcggccacgtcgccgtcggccatgtcatcaac
accgagccgcgcgacatgtacctgtcccgcgtggccgcgatcaacgccggtatcggcaag
gaaaccccggcgttcaacgtcaaccgcctgtgcgggtcggggctgcaggcgatcgtgtcg
gccgcccagaccatcatgctgggcgataccgagatcgccgtgggcgcgggcgccgaaagc
atgagccgcgcgccgtatatcgccccggcgcagcgctggggcgcgcgcatgggcgacagc
gccatggtcgacatgatgaccggcgcgctgtccgatccgtttggccgcatgcacatgggc
gtgacggccgagaacgtggcggcgcgctattccatcagccgcgccgaccaggacgcgctg
gcggtcgagtcgcatcgccgcgccgcggccgccatcgacgcgggccgctttcgcgaccag
atcgtcccggtgacgttgaagacgcgcaagggcgagacagtgttcgacaccgacgagcac
gtgcgccgcgacatcaccatcgaaggcatggcggccctgcggccggtgttccagaaggaa
aacggcacggtcacggcgggcaacgcgtcgggcctgaacgacggcgcgggggcggtggtg
ctgatgagcgcggccgcggcggcgcagcgcggcatcgcgccgatggcgcgcctggtggcc
tatgcgcatgccggcgtggaccccgagatcatgggcatcggcccggtgccggccacgcag
gccgcgctcaagcgcgctggcctgaccgtcgaccagctcgacgtgatcgaggccaacgag
gcgttcgccgcgcaggcctgcgcggtgacgcgccagctggagctggatcccgccaaggtc
aatccgaacggcagcggcatcagcctgggccatcccatcggcgcgaccggggccatcatc
acggtcaaggccttgtacgagttgcagcgcgtgggcggccgctacgcgctggtgacgatg
tgcatcggcggcgggcagggcatcgccgccattttcgagcgcgtctga

DBGET integrated database retrieval system