KEGG   Bordetella pertussis CS: BPTD_2752Help
Entry
BPTD_2752         CDS       T01846                                 

Definition
(GenBank) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00900  Terpenoid backbone biosynthesis
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPTD_2752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bpc01006]
    BPTD_2752
Enzymes [BR:bpc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BPTD_2752
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BPTD_2752
Prenyltransferases [BR:bpc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BPTD_2752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AEE68004
Position
complement(2996884..2997795)
Genome map
AA seq 303 aa AA seqDB search
MKQSHLACADWLRERAQHVEHVLDELLPGADIAPTRLHEAMRYAVLGGGKRVRAALVYAA
GQACPVNGSTLAVGASMDRAAAAVELIHAYSLVHDDLPCMDDDTLRRGRPTVHVQFDEAT
AMLAGDALQPLAFELLAGMPIAPALVVQAAQVLARAAGSQGMAGGQAIDLHSVGRMLTRD
ELQTMHSMKTGAMLACSVTLGGIVAGASSTARQALDSYAQAIGLAFQVVDDILDVTADTA
SLGKTAGKDAADNKPTYVSLLGLEQARALAQELRQAAHQALAPLGESGARLGQLADFIVL
RDR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaagtcatctcgcctgcgccgactggctgcgggaacgcgcgcagcatgtcgag
cacgtgctcgacgaattgctgcctggcgccgatatcgctcccacgcggctgcacgaagcc
atgcgctatgcggtgctgggcggcggcaagcgggtgcgcgcggccctggtctacgcggcc
gggcaggcctgccccgtcaacggcagcacgctggccgtcggggcgtcgatggaccgcgcc
gccgcggccgtcgagctgatccacgcctattcgctggtgcacgacgacctgccgtgcatg
gacgacgacacgctgcgccgcggccggcccacggtgcatgtgcaattcgacgaggccacg
gccatgctggccggcgatgccctgcagcctctggccttcgaactgctggccggcatgccg
atcgcgcccgcgctggtggtgcaggccgcccaggtcctggcgcgcgccgccggcagccag
ggcatggccggcgggcaggccatcgacctgcacagcgtgggccgcatgctcacgcgcgac
gaactgcagaccatgcacagcatgaagaccggcgccatgctggcgtgcagcgtgacgctg
ggaggcatcgtggccggcgccagctcgaccgcgcgccaggcgctcgacagctacgcgcag
gcgatcggcctggcgttccaggtcgtcgacgatatcctcgatgtgacggccgacaccgcc
agcctgggcaagacggccggcaaggatgcggccgacaacaagccgacctatgtatccttg
ctgggcctggagcaggcccgcgcgctggcgcaggagttgcgccaggcggcccaccaggct
ctggcgccgctgggcgagtccggcgcgcggctgggccaactggcagatttcatcgtactc
agagaccgctga

DBGET integrated database retrieval system