KEGG   Bordetella pertussis CS: BPTD_3088Help
Entry
BPTD_3088         CDS       T01846                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00900  Terpenoid backbone biosynthesis
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPTD_3088 (ipk)
Enzymes [BR:bpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BPTD_3088 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEE68311
Position
complement(3370815..3371714)
Genome map
AA seq 299 aa AA seqDB search
MTLYDVPAPAKLNLFLHVVGRRADGYHLLQTAFRFIDLADTLHFEARADGAIGRAYELPG
VAESDDLVMRAARSLQRATGTRQGAQIGLHKRIPQGGGLGGGSSDAATTLIALNRLWGTG
LSRSQLMQLALPLGADVPVFVFGQSAFAQGVGEDLTAVALSPAAYLVVQPDAGVPTAVIF
SDPDLTRDCASVTIADFLALPTSCFGRNDLEPVVLRRYPEVSGAVRWLFEHGLRVRMSGS
GACLFAEFPTLPEAVLAQEEITATMRVAGKTTSHTHPGFRLVQASTGLTEHPLRNWIAS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctctacgacgtacccgcacccgccaagttgaacctgtttctgcacgtggtgggc
cgccgcgccgacggctaccatctgctgcagaccgcgttccgcttcatcgacctggccgac
accctgcatttcgaagcgcgcgccgacggtgccatcggccgcgcgtacgaactgcctggc
gtggccgagtccgacgacctggtcatgcgcgccgcgcgcagcctgcagcgcgccaccggc
acccgccagggcgcgcagatcggcctgcacaagcgcatcccgcagggcggcggcctgggc
ggcggatcgagcgacgccgccaccaccctgatcgccctgaaccggctctggggcaccggc
ctgtcgcgcagccagttgatgcaactggcgctgccgctgggcgccgatgttccggtcttc
gtcttcggccagtcggccttcgcgcagggcgtgggcgaagacctgacggccgtggcgctg
tcgccggcggcctatctggtggtgcagcccgacgccggcgtgcccactgccgtcattttt
tccgaccccgatttgacaagggattgcgcttcggtcacaatagcggactttcttgctttg
ccaacttcctgctttggcaggaatgatctggagccggtggtgttgcggcggtatcctgag
gtttcaggggctgttcgctggcttttcgagcacggtttgcgtgttcggatgtcgggatct
ggggcgtgtcttttcgccgaatttcccaccctgccggaagccgttttggcacaagaggaa
ataaccgctacaatgcgcgtcgctggaaaaacaaccagccatacgcatcccgggttccgg
ttggtacaggctagtactggattgactgagcatccgttgcggaactggattgcaagctag

DBGET integrated database retrieval system