KEGG   Bordetella pertussis CS: BPTD_3226Help
Entry
BPTD_3226         CDS       T01846                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
bpc  Bordetella pertussis CS
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BPTD_3226 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AEE68429
Structure
PDB: 

Position
3524944..3525339
Genome map
AA seq 131 aa AA seqDB search
MSNRERPVKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITD
GEERVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTMRGTYHCVGENGIPFEVPIA
EFLLAMPRTLH
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaaccgggaaaggcctgtgaaaccctatgatctgaccgtatccgtgaccccgcgt
tatgtgccggagcagtccgatcccagtcagcagcaatacgtgtttgcctacacggtgcgc
atcaccaataccggttcgcacccggcccaggtcatcagtcgccactggatcatcaccgac
ggcgaggagcgcgtgcaggaagtgcgcggccttggcgtggtgggccagcaaccgctgctg
gcgccgggcgaaaccttcgaatacaccagcggctgtccgcttccgactcccatcggcacg
atgcggggcacctaccattgcgtgggcgaaaacggcattccgttcgaggtgccgattgcg
gagttcctgctggccatgccgcgtacactgcactga

DBGET integrated database retrieval system