KEGG   Bordetella pertussis CS: BPTD_3261Help
Entry
BPTD_3261         CDS       T01846                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00071  Fatty acid degradation
bpc00280  Valine, leucine and isoleucine degradation
bpc00281  Geraniol degradation
bpc00310  Lysine degradation
bpc00360  Phenylalanine metabolism
bpc00362  Benzoate degradation
bpc00380  Tryptophan metabolism
bpc00410  beta-Alanine metabolism
bpc00627  Aminobenzoate degradation
bpc00640  Propanoate metabolism
bpc00650  Butanoate metabolism
bpc00903  Limonene and pinene degradation
bpc00930  Caprolactam degradation
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01120  Microbial metabolism in diverse environments
bpc01130  Biosynthesis of antibiotics
bpc01212  Fatty acid metabolism
Module
bpc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPTD_3261
   00650 Butanoate metabolism
    BPTD_3261
  Lipid metabolism
   00071 Fatty acid degradation
    BPTD_3261
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPTD_3261
   00310 Lysine degradation
    BPTD_3261
   00360 Phenylalanine metabolism
    BPTD_3261
   00380 Tryptophan metabolism
    BPTD_3261
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPTD_3261
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPTD_3261
   00281 Geraniol degradation
    BPTD_3261
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPTD_3261
   00627 Aminobenzoate degradation
    BPTD_3261
   00930 Caprolactam degradation
    BPTD_3261
Enzymes [BR:bpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPTD_3261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEE68461
Position
3564057..3564878
Genome map
AA seq 273 aa AA seqDB search
MSETDTNPEHYARYRALRIRRHPEGILELVMGAKDASGKLSTADERLHRELADVWRDIDT
DDQTRVVVIRGEGNGFSGGGDLGLVQQMAEDFEVRTRVWREARDLVYNIINCNKPIVSAM
HGAAVGAGLVAGLLADISIAARDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLLL
CDAVSGEEAERIGLVSLCVDRAELLSKAFEVAGRLAAGSQTAIRWTKYALNNWLRMAGPS
FDTSLALEFMGFAGPDVHEGIKSLREKRAPDFR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacagacaccaatcccgagcactatgcccgctaccgggccttgcgcatccgc
cgccatccggagggcatcctggagctggtcatgggcgccaaggacgccagcggcaagttg
tccaccgccgacgagcgcctgcaccgcgagctggccgatgtgtggcgcgatatcgatacc
gacgaccagacccgggtggtggtgatccgtggcgaaggcaatgggttctcgggcggcggc
gatctggggctggtgcagcagatggccgaggatttcgaggtgcgcacccgggtctggcgc
gaggcgcgcgacctggtctacaacatcatcaactgcaacaagcccatcgtctcggccatg
catggcgcggcggtcggcgcggggttggtggcggggctgctggccgatatctcgatcgcg
gctcgcgatgcgcgcatcatcgatggccatacccggctgggggtggctgccggcgaccat
gccgccatcgtctggccgctgctgtgcggcatggccaaggccaagtactacctgttgctg
tgcgacgcggtcagcggcgaggaggccgagcgcatcggcctggtgtcgctgtgcgtggat
cgcgccgaactgctgtccaaggccttcgaagtggccggccgcctggcggccggctcgcaa
accgccattcgctggaccaagtacgccttgaacaactggctgcgcatggcgggcccgtcg
ttcgatacgtcgctggccctggagttcatgggttttgccgggcccgacgtgcacgaaggc
atcaagtcgctgcgcgagaagcgcgcgccggacttccggtaa

DBGET integrated database retrieval system