KEGG   Burkholderia pseudomallei 668: BURPS668_0075Help
Entry
BURPS668_0075     CDS       T00481                                 

Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00071  Fatty acid degradation
bpd00280  Valine, leucine and isoleucine degradation
bpd00281  Geraniol degradation
bpd00310  Lysine degradation
bpd00362  Benzoate degradation
bpd00380  Tryptophan metabolism
bpd00410  beta-Alanine metabolism
bpd00640  Propanoate metabolism
bpd00650  Butanoate metabolism
bpd00903  Limonene and pinene degradation
bpd00930  Caprolactam degradation
bpd01040  Biosynthesis of unsaturated fatty acids
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
bpd01130  Biosynthesis of antibiotics
bpd01200  Carbon metabolism
bpd01212  Fatty acid metabolism
Module
bpd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BURPS668_0075
   00650 Butanoate metabolism
    BURPS668_0075
  Lipid metabolism
   00071 Fatty acid degradation
    BURPS668_0075
   01040 Biosynthesis of unsaturated fatty acids
    BURPS668_0075
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS668_0075
   00310 Lysine degradation
    BURPS668_0075
   00380 Tryptophan metabolism
    BURPS668_0075
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BURPS668_0075
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BURPS668_0075
   00281 Geraniol degradation
    BURPS668_0075
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BURPS668_0075
   00930 Caprolactam degradation
    BURPS668_0075
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BURPS668_0075
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BURPS668_0075
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BURPS668_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_8 DAO NAD_binding_2 AlaDh_PNT_C F420_oxidored UDPG_MGDP_dh_N Pyr_redox_2 ApbA
Motif
Other DBs
NCBI-ProteinID: ABN84016
UniProt: A3N459
Position
I:70288..72411
Genome map
AA seq 707 aa AA seqDB search
MIDYTLDDDGIATLSWNLPARSQNVLNGESCEAFFAAAARALQDAAVKGMLVTSAKPDFI
AGGDLEWLQASDSAETLFARTCELHRALRALETGGKPVAIAMPGSALGGGLEIALAGHYR
VAADNPKARFGLPEVTLGLLPGGGGTQRLPRLVGVQASLPLLLEGKRLKAADALAAGILH
AVVPAGEEIAAARAWLLDASRRTATQPWDAKGFRIPGGALTHPSVQQVFMAANALARQKT
YGNYPAVASILSCVYEGLLTDLDTGLKTEARYFVKAVLSPEAKAMIRTLFFGMNEANKLA
ARPAGVPTQRYRKVGVLGAGMMGAGIAYVSAKAGLDVVLIDTGEEAAARGKDYSRKLVDK
QVQRGRLAREKADALLAKIVPTTDFARLDGAQLVIEAVFEDRAIKADVTRRSEAVLAPDA
LFASNTSTLPITGLAQASARPANFIGLHFFSPVDKMPLVEVIVGRDTSEATLARALDYVK
TIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVAPALIENAGLLAGMPVGPLALTDE
VSSELIHKITRQTRADLGDAYVARPGEDVAARMVELGRLGRKAGLGYYDYPASGGKKALW
PGLAQEFPLAAEQPDVAALIERLVTVQAVETARCLEERVLTTARDADVGAILGWGFPAFR
GGPASYIHGVGVDAFVATCDRLAARHGARFAAPALLREMAAQGRSFY
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattacacgctcgatgacgacggcatcgcgaccttgagctggaacctgccggcg
cgcagccagaacgtgctgaacggcgagagctgcgaggcgttcttcgcggcggcggcgcgc
gcgttgcaggatgcggcggtgaagggaatgctcgtcacgtcggcgaagcccgacttcatc
gcgggcggcgacctcgaatggctgcaggcgagcgacagcgccgagacgctcttcgcgcgc
acgtgcgagctgcatcgcgcgctgcgcgcgctcgagacaggcggcaagccggtggcgatc
gcgatgccgggctcggcgctcggcggtgggctggagatcgcgctcgcgggccactatcgt
gtcgcggccgacaatccgaaggcgcgcttcggcctgcccgaagtgacgctcggcctgctg
ccgggcggcggcggcacgcagcgcctgccgcgtctcgtcggcgtccaggcgtcgctgccg
ctattgctcgaaggcaagcggctgaaggcggccgacgcgctggccgcgggcatcctgcat
gcggtcgtgccggcgggcgaggagatcgcggccgcgcgcgcgtggttgctcgacgcgagc
cgccgcaccgcgacgcagccgtgggacgcgaagggcttccggattccgggcggcgcgctc
acgcatccgtccgtccagcaggtgttcatggcggcgaacgcgctcgcgcggcagaagacg
tatggcaactacccggccgtcgcgagcatcctgtcgtgcgtgtacgaagggctgctgacc
gatctcgacacgggcttgaagaccgaggcgcgctatttcgtgaaggcggtgctgtcgccg
gaagcgaaggcgatgatccgcacgctgttcttcgggatgaacgaagcgaacaagctcgcc
gcgcggccggccggcgtgccgacgcagcgctaccggaaggtcggcgtgctcggcgcgggg
atgatgggcgcgggcatcgcgtacgtgagcgcgaaggcggggctcgacgtcgtgctgatc
gataccggcgaagaggcggccgcgcgcggcaaggactattcgcgcaagctcgtcgacaag
caggtgcagcgcggccggctcgcgcgggaaaaggccgatgcattgctcgcgaagatcgtg
ccgacgacggatttcgcgcggctcgacggcgcgcagctcgtgatcgaggcggtgttcgag
gatcgcgcgatcaaggccgacgtcacgcgccggagcgaagcggtgctcgcgcccgacgcg
cttttcgcgtcgaacacgtcgacgctgccgatcacggggctcgcgcaggcgagcgcgcgg
ccggcgaacttcatcggcctgcatttcttctcgccggtggacaagatgccgctcgtcgag
gtgatcgtcggccgcgacacgagcgaggcgacgctcgcgcgcgcgctcgactacgtgaag
acgatcggtatgacgccgatcgtggtcaacgattcgcggggcttctacacgagccgcgtg
ttttcgacgtacgtgctcgaagggctcgcgatgctcgccgagggcgtcgcgcccgcgctg
atcgagaacgccggattgctcgccggcatgccggtgggcccgctcgcgctgaccgacgag
gtgtcgagcgagctgatccacaagatcaccaggcagacgcgcgccgatctcggcgacgcg
tacgtcgcgcgccccggcgaggacgtggccgcgcgcatggtcgaactcggccggctcggc
cgcaaggcggggctcggctattacgactatccggcgagcggcggcaagaaggcgctgtgg
ccggggctcgcgcaggagtttccgctcgcggccgagcagcccgacgtggcggcgctgatc
gagcggctcgtgacggtgcaggcggtcgagaccgcgcgctgcctcgaagagcgcgtgctg
acgacggcgcgcgatgcggacgtcggcgcgattctcggctggggtttcccggcgttccgc
ggcgggccggcgtcgtacattcacggcgtcggggtggacgcgttcgtcgcgacgtgcgat
cgtcttgccgcgcggcacggcgcgcgtttcgccgcgccggcgttgctgcgcgagatggcg
gcgcaggggcgaagcttctactga

DBGET integrated database retrieval system