KEGG   Burkholderia pseudomallei 668: BURPS668_1089Help
Entry
BURPS668_1089     CDS       T00481                                 

Gene name
hisQ
Definition
(GenBank) histidine ABC transporter, permease protein HisQ
  KO
K10016  histidine transport system permease protein
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BURPS668_1089 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpd02000]
    BURPS668_1089 (hisQ)
Transporters [BR:bpd02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BURPS668_1089 (hisQ)
   Histidine transporter
    BURPS668_1089 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 ASC
Motif
Other DBs
NCBI-ProteinID: ABN82462
UniProt: A3N718
Position
I:complement(1067551..1068240)
Genome map
AA seq 229 aa AA seqDB search
MFLQGYGPLILSGTWQTVKLAVLSLALSFLLGLVGAAAKLSRNRVSNGIGTLYTTLIRGV
PDLVLMLLLFYSLQIWLNQLTDLMNWDQIDIDPFAAGVLVLGFIYGAYFTETFRGAFLSV
PRGQLEAGSAYGMTNWQVFARVMFPQMMRFALPGIGNNWQVLVKSTALVSIIGLADVVKA
SQDAGKGTLRFFFFTLLAGAIYLAITTISNFVLMWLEKRYSTGVRKADL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttcaaggctacggcccgctgatactctccggcacctggcagaccgtcaagctc
gcggtgctgtcgctcgcgctgtcgttcctgctcggcctcgtcggcgcggcggcgaaactg
tcgcgaaaccgcgtctcgaacggaatcggcacgctctacacgacgctcattcgcggcgtg
ccggacctcgtgctgatgctgctcctcttctacagcctgcagatctggctgaaccagctc
accgatctgatgaactgggatcagatcgacatcgatccgttcgcggccggcgtgctcgtg
ctcggcttcatctacggcgcgtacttcaccgaaaccttccgcggcgcgttcctgtcggtg
ccgcgcggccagctcgaggccggcagcgcgtacgggatgacgaactggcaggtgttcgcg
cgcgtcatgttcccgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaatcgacggcgctcgtgtcgatcatcggcctcgccgacgtggtgaaggcg
tcgcaggacgcgggcaagggcacgctgcggttcttcttcttcacgctgctcgccggcgcg
atctatctcgcgatcacgacgatctcgaacttcgtgctgatgtggctcgagaagcgttat
tcgaccggcgtacgcaaggcggacctatga

DBGET integrated database retrieval system