KEGG   Burkholderia pseudomallei 668: BURPS668_1287Help
Entry
BURPS668_1287     CDS       T00481                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00010  Glycolysis / Gluconeogenesis
bpd00051  Fructose and mannose metabolism
bpd00562  Inositol phosphate metabolism
bpd00710  Carbon fixation in photosynthetic organisms
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
bpd01130  Biosynthesis of antibiotics
bpd01200  Carbon metabolism
bpd01230  Biosynthesis of amino acids
Module
bpd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bpd_M00002  Glycolysis, core module involving three-carbon compounds
bpd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS668_1287 (tpiA)
   00051 Fructose and mannose metabolism
    BURPS668_1287 (tpiA)
   00562 Inositol phosphate metabolism
    BURPS668_1287 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BURPS668_1287 (tpiA)
Enzymes [BR:bpd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BURPS668_1287 (tpiA)
Exosome [BR:bpd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BURPS668_1287 (tpiA)
  Exosomal proteins of bladder cancer cells
   BURPS668_1287 (tpiA)
  Exosomal proteins of melanoma cells
   BURPS668_1287 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABN83779
UniProt: A3N7L5
Position
I:1258937..1259737
Genome map
AA seq 266 aa AA seqDB search
MNTTPGFGASTTRQTMSKQRIKRVIGNWKMHGRLSGNEALLDEVAQGAQAVPEHVGIGVC
VPFPYLAQARARLHGGRVAWGAQDVSAHEQGAFTGEVAAGMVAEFGAAYAIVGHSERRAY
HGESNEIVAAKAQRALAVGLTPVVCVGETLAEREAGATERVVGVQLDAVLAVLSQDEAAR
IVVAYEPVWAIGTGRSATAEQAQQVHAFLRGRLAAKGAERVSLLYGGSVKADNAAELFGQ
PDIDGGLIGGASLKSGDFLAICRAAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgcccggcttcggcgcgtccacgacgagacaaacgatgtcgaaacaaaga
atcaagcgggtgatcggcaactggaagatgcacggtcgcctgagcggcaacgaggcgctg
ctcgacgaagtcgcgcagggcgcgcaagccgtgcccgagcacgtcggcatcggcgtgtgc
gtgccgtttccgtatctcgcgcaggcgcgggcccggcttcacggcggtcgcgtcgcgtgg
ggcgcgcaggacgtgtccgcgcacgagcagggcgcctttaccggcgaagtcgcggccggc
atggtcgcggagttcggcgcggcgtacgcgatcgtcgggcactcggagcgccgcgcgtat
cacggcgaatcgaacgagatcgtcgcggcgaaggcgcaacgtgcgctcgccgtggggctg
acgcccgtcgtgtgcgtcggcgagacgctcgccgagcgcgaagcgggcgcgaccgagcgg
gtcgtcggcgtgcagctcgacgcggtgctcgcggtgctgtcgcaggacgaggcggcgcgc
atcgtcgtcgcgtacgagcccgtatgggcgatcggcacgggccgcagcgcgacggcggag
caggcgcagcaggtgcacgcgttcctgcgcgggcggctcgcggcgaagggcgccgagcgc
gtgtcgctgctgtatggcggcagcgtgaaggccgacaacgcggccgagctgttcggccag
cctgacatcgacggcggcctgatcggcggcgcgtcgttgaagagcggggatttcctggcg
atttgccgggcggcgcagtaa

DBGET integrated database retrieval system