KEGG   Burkholderia pseudomallei 668: BURPS668_1509Help
Entry
BURPS668_1509     CDS       T00481                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00010  Glycolysis / Gluconeogenesis
bpd00620  Pyruvate metabolism
bpd00640  Propanoate metabolism
bpd00680  Methane metabolism
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
bpd01130  Biosynthesis of antibiotics
bpd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS668_1509
   00620 Pyruvate metabolism
    BURPS668_1509
   00640 Propanoate metabolism
    BURPS668_1509
  Energy metabolism
   00680 Methane metabolism
    BURPS668_1509
Enzymes [BR:bpd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BURPS668_1509
Lipid biosynthesis proteins [BR:bpd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BURPS668_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABN84138
UniProt: A3N880
Position
I:complement(1471304..1472971)
Genome map
AA seq 555 aa AA seqDB search
MHRNGIRKNDRRRTMLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHEH
AHGVVARYTFDELRSSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAIAV
PLFTLFGADALEFRLGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAEPGV
LAFDAALAAESDTFRPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQNL
FPARARLFWTPADWAWIGGLLDVLLPSLHHGVPVLARRFEKFDGAAAFDLLARHGVTHAF
LPPTALKLMRAAVARPHERYALALESVASGGESLGAELVSWGRDAFGVTINEFYGQTECN
VVLSSCSALFEPRAGTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVMFIGYWRR
LEATREKFAGDFLLTGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDCLLEHPAVR
MAAVVGVPDAVRTEIVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPRALAFVDSLP
MTATGKIIRRALRDI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcgaaacggcatacgaaaaaacgaccggagacgcacgatgctgccccacgccgcc
cattacgccgagctcgtcgagcgcttcgcctggcgggttcccgcgcactacaacatcggc
gtcgacgcgtgcgacaaatgggccgatggcagcggccgcctcgccctgatccacgaacac
gcgcacggcgtcgtcgcacgttacacgttcgacgaactgaggagcagctctaatcgactc
gcgaacagcttcgcgcgcgcaggcgtgaagcgcggcgaccgcatcggcatcctcctcgcg
caaggcccggaaacggcgatcgcccatctggccgcatacaagctcggcgcgatcgcggtg
ccgctcttcacactcttcggcgcggacgcgctcgaattccgcctcggcgatagcggcgcc
gtcgcgctcgtcaccgatcgcgccggttacgagaaaatcgcgccgctgcatgcgtcgctg
ccgtcgctcgcgacgatctactgcatcgacggcgcgcccgatctcgccgagcccggcgtg
ctcgcgttcgatgcggcgctcgcggccgaatcggacacgttccggcctgcggacacgtcg
gccgacgatccggcgctcatcatctacacgtccggcacgacgggcaaaccaaagggcgcg
ctgcacgcgcatcgggtgctgctcggccatctgcccggcgtcgagatgtcgcagaacctg
tttccggcgcgtgcgcgcctgttctggacgcccgccgattgggcatggatcggcgggctg
ctcgacgtcctgctgccgtcgctgcaccacggcgtgccggtcctcgcgcgacgcttcgag
aaattcgacggcgcggccgcgttcgatctgctcgcccggcacggcgtgacgcacgcgttc
ctgccgccgaccgcgctgaagctgatgcgcgcggctgtcgcgcggccgcatgaacgttac
gcgctcgcgctcgaatcggtagcgagcggcggcgaatcgctcggcgccgaactcgtttcc
tggggccgcgacgcgttcggcgtgacgatcaacgagttctacggacagaccgaatgcaac
gtcgtgctgtcgtcgtgcagcgcgctgttcgagccgcgcgcggggacgatcggcaaggcg
gcgcccgggcatcgcgtcgcgatcgtcgacgatgccggcaacgcgctgccgcccggcgtc
acgggcaacatcggcgtgcgcgcgcccgaccccgtgatgttcatcggctactggcgcagg
ctcgaggcgacgcgcgagaagttcgccggcgacttcctgctgacgggcgacctcggcatc
gccgacgccgacggtttcatccgcttcgtcggccgcaacgacgacgtgatcacgagcgcc
ggctaccggatcggcccgggaccgatcgaggattgcctgctcgagcatccggcggtgcgg
atggcggccgtcgtcggcgtgccggacgcggtccgcaccgaaatcgtcaaggcgttcgtc
gtgctgaacgccggctatgaaggaagcgccgcgctcgcccgcgagctgcaaacgcacgtg
aagacacggctcgccgcacacgaatatccgcgtgcgctcgccttcgtcgacagcctgccg
atgaccgcgaccggcaagatcatccgccgcgcgctgcgcgacatctga

DBGET integrated database retrieval system