KEGG   Burkholderia pseudomallei 668: BURPS668_1584
Entry
BURPS668_1584     CDS       T00481                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpd  Burkholderia pseudomallei 668
SSDB
Motif
Pfam: DUF2235
Other DBs
NCBI-ProteinID: ABN84541
UniProt: A3N8F4
Position
I:1549545..1551854
AA seq 769 aa
MACCKTLHIGIFFDGTRNNADRDRGARKESNVARLYAAFPIDKYHQAIYVAGVGTPFVEQ
IGDFGVGLQAAAGAAAGWAGEGRINWALLRIHDILHAYVHGQTLTAVLGKRYEELVKSMS
LDMNFKGIDLGGTPPKPGSFGDIKLRANSGVGALKLIAAEQNGVELTWDLDTNWAQLKNE
LDSSKWNAAVQEWDAKRRKVLLDRRAQLKARIGDLLVKGKPKLQRIRLYVFGFSRGAAEA
RTFSNWLADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWGRKELMA
VPHYVRRCVHMVAAHEPRGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDD
ADKLSQVPLLDMYREARKAGVPLDINGPGIGADVIAAFKVSAGLKQAFAAYVKKSENYYY
EKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAAQARYPQDAADLDSANAELKEEWN
DLLEVEKAGGPTITRYVEKFVTKWASENPKTAAVVSTSLLPAAVAAEVFVPGVSAATVLF
GDKVVKLVQAQLKEKWEQWLQVRSDWNMGPPEPAISALYDNYMHDSRAWFKPLGDDDDVW
NHRQIQELKTKQASFERAHAAWKKRVEMGMPSPLQVTQAMGVGSTGWGPVGGLPPEPEPR
SPLTAQQADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFL
WGFLRWRTVFVNGVRWDQPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcttgttgtaagacattgcatatcggaattttctttgatggtacgcgtaacaacgct
gatcgggataggggggcgcgaaaggaaagcaatgtggcacggctttatgccgcttttcca
atcgataaatatcaccaagcgatttacgttgctggagttggcacgccttttgtcgagcag
attggtgatttcggtgttggcttacaggcggccgcaggagctgcggcaggttgggcggga
gaggggcgaattaactgggcgttgcttcggattcacgatattttgcatgcgtatgttcac
ggtcagacgttaacggcagtgttaggaaagcgctacgaggaactcgtaaaatcgatgagc
ctcgatatgaattttaagggcatcgaccttggcggaacgccgcctaaaccgggaagcttc
ggcgatatcaaattgcgtgccaattctggtgtgggggcgctcaagctgattgctgccgaa
cagaatggtgtcgagctgacttgggatttagatacgaattgggcgcagctcaaaaacgag
ttggattcgtcgaagtggaatgcagccgtgcaagaatgggacgccaagcgccgcaaggta
ttgctcgatcgtcgtgctcagctaaaagcgcgcattggtgatctgctggtcaaggggaag
ccgaagctgcaacgcattcggctatacgtattcggtttttcgcgcggcgcagcggaggct
cgcactttctcgaactggcttgctgacgcgcttgaccccgatttcagtttgtgtggagtg
ccggtttcatacgattttctcggcatctttgatacggtcgcatcggtcggcatcgctcag
agcgccgccgcaacattattcgacggacatggaggatgggggcgcaaggaactgatggcc
gtgccgcattatgtgcgccgttgcgtgcacatggtggcggcacatgaaccgcgtggatca
tttccgctcgaccttatcgattgttcgatggacggtcgtgaggagattgtctacccgggt
gttcactcggacgtcggcggcggctatgggccgggcgaacaggggcgcggtcgggacgac
gccgacaaactttcgcaagtcccgctgcttgatatgtaccgggaggcgcgtaaggcaggt
gtgcccttggatatcaatgggccgggtatcggcgcggacgtcatcgctgcattcaaggtt
tcagcagggctaaaacaagccttcgcagcctacgtaaaaaagagcgagaactattattac
gagaaagatcacggcacgccgggcctaatgcgttgccattacggcttgtatctccggtgg
cgcaagatgcggctcaaggacatgcatgcacagcccagcttcaaggctgcgcaggcgcgc
tatccgcaagatgcagcggatctggacagtgcgaacgcggaattgaaggaggagtggaac
gatttgctggaggtcgagaaagctggcggcccgacaatcacccgatacgtggagaagttt
gttacgaaatgggccagtgagaatccgaaaacggccgccgtcgtttccacgtctctactt
ccggccgcggtcgctgctgaggtttttgttccgggggttagcgctgcgacggttctattc
ggcgacaaagtagtgaaactggtgcaagcccaactcaaggagaagtgggagcagtggctg
caagttcgcagcgactggaacatggggccgcctgaacctgcgatcagcgcactctacgac
aactacatgcacgactcccgcgcatggttcaagccgctcggcgacgatgacgacgtgtgg
aaccataggcagattcaggaactcaagaccaagcaagccagctttgaacgcgcccatgct
gcctggaaaaagcgtgtcgaaatgggcatgccaagcccgttgcaggttacacaggcaatg
ggcgtaggttccacaggatgggggcccgtcggcgggcttccgcccgaacccgaaccccgc
tccccgctcaccgcccagcaagccgatctgctcaagcgctacgacgccgcgatgcagtcc
gccaagcaggcacgcgccgcaaaggacccgaacgcgccgacggacagcgccgtgctgacc
gatccgaaggtgacgggcggcctcgcgctgcaaaccagcggccgcgagttctatttcctg
tggggcttcctgcgctggcggaccgtgttcgtgaacggcgtgcgctgggaccagccgcgc
gtgccgacggtgcaggaggaaatggagggcatgcgcatgcagatgcaacgccaggtcgat
atgaagggcatcggcgtactgttccaatga

DBGET integrated database retrieval system