KEGG   Burkholderia pseudomallei 668: BURPS668_1907
Entry
BURPS668_1907     CDS       T00481                                 

Gene name
rbsB_2
Definition
(GenBank) ribose ABC transproter, periplasmic ribose-binding protein
  KO
K10439  ribose transport system substrate-binding protein
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd02010  ABC transporters
bpd02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BURPS668_1907 (rbsB_2)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BURPS668_1907 (rbsB_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpd02000]
    BURPS668_1907 (rbsB_2)
Transporters [BR:bpd02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    BURPS668_1907 (rbsB_2)
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 SBP_bac_11 Glyco_hydro_3_C
Other DBs
NCBI-ProteinID: ABN83179
UniProt: A3N9C1
Position
I:1868955..1869902
AA seq 315 aa
MMHTALSTPASGRRAARALRAAALSLALGAASAAHAAPLKIGMTFQELNNPYFVTMQKAL
DEAAASIGAQVIVTDAHHDVSKQVSDVEDMLQKKIDILLVNPTDSTGIQSAVVSAKKAGA
VVVAVDANANGPVDAFVGSKNFDAGAMSCDYLAKAIGGGGEVAILDGIPVVPILERVRGC
RAALAKFPNVRIVDVQNGRQERASALAVTENMIQAHPLLKGVFSVNDGGSMGALSAIEAS
GRDIKLTSVDGAPEAIAAMQKPNSKFIETSAQFPRDQIRLAIGIGLAKKWGANVPKAIPV
DVKRIDKGNAKTFSW
NT seq 948 nt   +upstreamnt  +downstreamnt
atgatgcacaccgccttgtcgacgccggcttccggccgccgggccgcccgcgcgctgcgc
gccgccgcgctttcgctcgcgctcggcgcggcgagcgccgcgcacgcggcgccgctgaag
atcggcatgacgttccaggaactgaacaacccgtacttcgtgacgatgcaaaaggcgctc
gacgaggcggccgcgtcgatcggcgcgcaggtgatcgtcaccgacgcgcatcacgacgtg
agcaagcaggtgagcgacgtcgaggacatgctgcagaagaagatcgacatcctgctcgtg
aacccgaccgattcgacgggcatccagtcggccgtcgtgtcggcgaagaaggcgggcgcc
gtcgtcgtcgcggtggacgcgaacgcgaacggcccggtcgacgcgttcgtcggctcgaag
aatttcgacgcgggcgcgatgtcgtgcgactacctcgcgaaggcgatcggcggcggcggc
gaagtcgcgatcctcgacggcatcccggtcgtgccgattctcgagcgcgtgcgcggctgc
cgcgcggcgctcgcgaaattcccgaacgtgaggatcgtcgacgtgcagaacggcaggcag
gagcgcgcgagcgcgctcgccgtcaccgagaacatgatccaggcgcacccgttgctcaag
ggcgtcttcagcgtcaacgacggcggctcgatgggcgcgctgtccgcgatcgaggcgtcg
ggccgcgacatcaagctcacgagcgtcgacggcgcgccggaggcgatcgcggcgatgcag
aagccgaactcgaagttcatcgagacgtccgcgcagttcccgcgcgaccagattcgcctc
gcgatcggcatcgggctcgcgaagaagtggggcgccaatgtgccgaaggcgattccggtc
gacgtgaagcggatcgacaagggcaacgcgaagacgttcagttggtga

DBGET integrated database retrieval system