KEGG   Burkholderia pseudomallei 668: BURPS668_2292Help
Entry
BURPS668_2292     CDS       T00481                                 

Definition
(GenBank) acetyl-CoA acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00071  Fatty acid degradation
bpd00072  Synthesis and degradation of ketone bodies
bpd00280  Valine, leucine and isoleucine degradation
bpd00310  Lysine degradation
bpd00362  Benzoate degradation
bpd00380  Tryptophan metabolism
bpd00620  Pyruvate metabolism
bpd00630  Glyoxylate and dicarboxylate metabolism
bpd00640  Propanoate metabolism
bpd00650  Butanoate metabolism
bpd00900  Terpenoid backbone biosynthesis
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
bpd01130  Biosynthesis of antibiotics
bpd01200  Carbon metabolism
bpd01212  Fatty acid metabolism
bpd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BURPS668_2292
   00630 Glyoxylate and dicarboxylate metabolism
    BURPS668_2292
   00640 Propanoate metabolism
    BURPS668_2292
   00650 Butanoate metabolism
    BURPS668_2292
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BURPS668_2292
   00072 Synthesis and degradation of ketone bodies
    BURPS668_2292
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS668_2292
   00310 Lysine degradation
    BURPS668_2292
   00380 Tryptophan metabolism
    BURPS668_2292
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BURPS668_2292
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BURPS668_2292
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BURPS668_2292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpd04147]
    BURPS668_2292
Enzymes [BR:bpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BURPS668_2292
Exosome [BR:bpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS668_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABN85057
UniProt: A3NAF6
Position
I:complement(2271743..2272921)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTGLAKSWRGAFNMTHGATLGGHVVAAAVERAKLDPARVEDVLIGCANPE
GATGANIARQIALRAGLPVGVPGMTVNRFCSSGLQTIALAAQRVIAGEGDVFVAGGVESI
SCVQNEMNRHMLREGWLDAHKPEIYWTMLQTAENVAKRYGISKARQDEYGVNSQLRAAAA
QAAGRFNAEIVPITVRAGVADKATGRLYTKEVTLAADEGIRPDTTLEGVAKIRAALPGGV
ITAGNASQFSDGAAACVVMNAKVAEREGLAPLGIFRGFAVAGCEPDEMGIGPVYAVPKLL
KQAGLKVSDIDLWELNEAFAVQVLYCRDTLGIPDDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGAKYVVVTMCIGGGQGAAGLFEVV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcccgcaccgggctcgcgaaatcctggcgcggc
gcgttcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggcggccgtcgag
cgcgcgaagctcgatcccgcgcgcgtcgaggacgtgctgatcggctgcgcgaacccggaa
ggcgcgacgggcgcgaacatcgcgcggcagatcgcgctgcgcgcggggctgcccgtcggc
gtgccggggatgaccgtcaaccgcttctgctcgtcgggattgcagacgatcgcgctcgcc
gcgcagcgcgtgatcgcgggcgagggcgacgtgttcgtcgcgggcggcgtcgaatcgatc
tcgtgcgtgcagaacgagatgaaccgccacatgctgcgcgagggctggctcgacgcgcac
aagccggagatctactggacgatgctgcagacggccgagaacgtcgcgaagcgttacggc
atctcgaaggcgcgccaggacgagtacggcgtgaattcgcagctgcgcgcggccgccgcg
caggcggcggggcgctttaacgccgagatcgtgccgatcaccgtgcgcgcgggcgtcgcc
gacaaggcgacgggccgcctctacacgaaggaggtgacgctcgccgccgacgagggcatt
cggcccgacacgacgctcgagggcgtcgcgaagatccgcgcggcgctgccgggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcggccgcgtgcgtcgtgatgaac
gcgaaggtggccgagcgcgagggcctcgcgccgctcggcattttccgcggcttcgcggtg
gccggctgcgagccggacgagatgggcatcgggcccgtctacgcggtgccgaagctgctg
aagcaggcggggctcaaggtgtccgacatcgatctgtgggaactgaacgaggcgttcgcg
gtgcaggtgctctattgccgcgacacgctcgggattcccgacgatcggctgaacgtgaac
ggcggcgcgatcgcggtcggccatccgtacggcgtatcgggcgcgcggctcaccggccac
gcgctgatcgagggcaagcggcgcggcgcgaaatacgtcgtcgtgacgatgtgcatcggc
ggcgggcagggcgcggcggggctgttcgaggtggtgtga

DBGET integrated database retrieval system