KEGG   Burkholderia pseudomallei 668: BURPS668_2912Help
Entry
BURPS668_2912     CDS       T00481                                 

Definition
(GenBank) amidase family protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00970  Aminoacyl-tRNA biosynthesis
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BURPS668_2912
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bpd03029]
    BURPS668_2912
Enzymes [BR:bpd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BURPS668_2912
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BURPS668_2912
Mitochondrial biogenesis [BR:bpd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BURPS668_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABN84245
UniProt: A3NC59
Position
I:2869555..2870973
Genome map
AA seq 472 aa AA seqDB search
MPIRFVNPIEPDTVMTTFAPFPPLARLAADLAAGVTTSRALVEAALERIADPAGQGALAF
TEVDAPRARAAADAHDRLRAAGTVLSPLAGIPVSVKDLFDVAGQVTRAGSRVLADAPPAA
DDAVAVARLKRAGAVLVGRTNMSEFAFSGLGLNPHYGTPRSPYRRDVPGDERIAGGSSSG
AAASVADGMAAVALATDTGGSIRIPAALCGLTGFKPTASRIPKQGGVPLSTTLDSFGPIG
VSVACCALVDRILAGLEPHVCAARPLEGVRLGVLTNYVTDGMDAHVATSLDAALKHLEAA
GAIVSDARFAPLDTLPGINRIGFASIEAHAWHRPLVARHRDAYDPRVLARILKGEPASAA
DYLDLVAARAALIDEAARTVWQRFDALVAPTVPIAPPRIAELERDDDAFARTNALVLRNP
SAFNFLDACALSLPCHPRDTAPVGLMLAAAPHHDDALLAIGQAVEAVLATIR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgccgatccgcttcgtcaacccgatcgaacccgataccgtcatgaccactttcgccccc
ttcccgccgctcgcccgcctcgccgccgatctcgccgccggcgtgacgacgagccgcgcg
ctcgtcgaagccgcgctcgaacggatcgccgatccggcggggcaaggcgcgctcgcgttc
accgaggtcgacgcgccacgcgcgcgcgcggccgccgacgcgcacgatcgcctgcgcgcg
gcgggcaccgtgctgtcaccgctcgcgggcattccggtgtcggtgaaggatctgttcgac
gtcgcgggccaggtcacgcgcgcgggctcccgcgtgctcgccgacgcgcccccggccgcc
gacgacgccgtcgcggtcgcccgcctcaagcgcgcgggcgccgtgctcgtcggccgcacg
aacatgagcgaattcgcgttctccggcctgggcctcaatccgcactacggcacgccgcgc
tcgccgtaccggcgcgacgtgccgggcgacgagcggatcgcgggcggctcgtcgtcgggc
gcggccgcatcggttgcggacggcatggcggccgtcgcgctcgcgaccgatacgggcggc
tcgatccgcatccccgccgcgctctgcggactgacgggcttcaagccgaccgcgagccgg
attccgaagcaaggcggcgtgccgctgtcgacgacgctcgattcgttcggcccgatcggc
gtatcggtcgcgtgctgcgcgctcgtcgaccggatcctcgcgggcctcgagccgcacgtg
tgcgccgcacgcccgctcgagggcgtgcggctcggcgtgctgacgaactatgtgacggac
ggcatggacgcgcacgtcgccacgtcgctcgacgccgcgctcaagcatctggaagcggcg
ggcgcgatcgtgtcggacgcgcgcttcgcgccgctcgacacgctgcccggcatcaaccgc
atcggtttcgcttcgatcgaggcgcatgcgtggcatcgcccgctcgtcgcgcgccaccgc
gacgcgtacgatccgcgcgtgctcgcgcgcatcctgaagggcgagccggcgagcgccgcc
gattacctcgatctcgtcgccgcgcgcgcggcgctcatcgacgaggcggcgcgcaccgtg
tggcagcgcttcgacgcgctcgtcgcgccgacggtgcccatcgcgccgccgcgcatcgcc
gagctcgaacgggacgacgacgcgttcgcccgcacgaacgcgctcgtgctgcgcaacccg
agcgcgttcaattttctcgatgcgtgcgcgctatcgctgccgtgccatccgcgcgacacg
gcgcccgtcggcctgatgctcgccgccgcaccgcatcacgacgacgcgctgctcgcgatc
ggccaggcggtcgaagcggtgctcgcgacgatccgctga

DBGET integrated database retrieval system