KEGG   Burkholderia pseudomallei 668: BURPS668_3552Help
Entry
BURPS668_3552     CDS       T00481                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BURPS668_3552 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ABN81421
UniProt: A3NDY6
Position
I:complement(3486748..3487122)
Genome map
AA seq 124 aa AA seqDB search
MSQYRFSVSVKTSYLPEQSDPEHRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESQVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatcgattcagcgtgtcggtgaagaccagctatttgccggaacaatccgac
cccgaacaccgtcaatacgcattcgcgtacacgctgacgatccgcaatacggggcaggtg
gccgcgcagttgatcgcccggcactggatcatcacggacagcgagagccaggttcaggag
gtgaaggggctcggcgtcgtcggccatcagccgttgctgcagccgggcgagcagttcgag
tacacgagctgggcggtgatcgcgacgccggtgggcacgatgcgcggcgcgtatttttgc
gtcgcggaggacggtgagcgcttcgaggcgcccgtcgacgaattcgcgctgcacatgccg
cgcacgctgcactga

DBGET integrated database retrieval system