KEGG   Burkholderia pseudomallei 668: BURPS668_3635
Entry
BURPS668_3635     CDS       T00481                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpd02044]
    BURPS668_3635
Secretion system [BR:bpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS668_3635
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABN83973
UniProt: A3NE69
Position
I:complement(3561834..3562352)
AA seq 172 aa
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEIEQPKLRDR
KFVNIDRDNFDDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcgaagaaagaaagcattcaaaagcgcttgcagaaagtgcggccgccccgcgtccag
ttgacgtacgaggtcgaacggggcgatgcgatcgagatcaaggagctgccgttcgtcgtc
ggggttgtcggcgatctggcggggcagtccgaaatcgagcagccgaagctgcgcgatcgc
aagttcgtcaacatcgaccgcgacaacttcgatgacgtgatgaaggcgatcgagccgcgc
gcgacgttccaggtggagaaccgcctgagcgaggcgggcggcaagttcgcggtcgacctg
aagttccgctcgatcaacgatttcaatccggacgaagtcgtcgggcaggtcgagccgctg
cgccgcctgctcgaggcgcgctcgaagctcgcggacctgcgcaacaaactggccggcaac
gacaagctcgaagacctgctgagcgaagtgctgtcgaacacgcagcagctcgaagcgctg
aagaagagcgcggacggcggcgacaagcagggcgaatga

DBGET integrated database retrieval system