KEGG   Burkholderia pseudomallei 668: BURPS668_A0057Help
Entry
BURPS668_A0057    CDS       T00481                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00040  Pentose and glucuronate interconversions
bpd00053  Ascorbate and aldarate metabolism
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BURPS668_A0057
   00053 Ascorbate and aldarate metabolism
    BURPS668_A0057
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BURPS668_A0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABN86725
UniProt: A3NFE2
Position
II:46891..48471
Genome map
AA seq 526 aa AA seqDB search
MQITGEMLIGAAAVRGSEGTMRAYAPAQGVELEPTFGAGGAADVDRACRLANAAFDPFRQ
APLETRARFLEAIAERIVGLGDPLIERAHAESALPVARLEGERARTVGQLRLFAAIVRDG
RWLSATLDSAQPERKPLPRADLRLQKIPVGPVAVFGASNFPLAFSVAGGDTASAFAAGCP
VVAKAHPAHLGTSELVGRAIRQAVADCGLHEGVFSLVVGAGNAIGEALVAHPAIRAVGFT
GSRAGGLALMGVAARRREPIPVFAEMSSINPFFVLPGALRARGAQIAQGFVESLTLGVGQ
FCTNPGLVVALEGPDLKAFVDAAAQALSQKGAQTMLTSGIASSYESAVAARRAAAGVSEV
ARGVRSDARNAALPALFTTTHTQFVQNPQLEAEIFGPTSLVVACRDIDEMIALAEHVEGQ
LSATLHLEDDDVDLARKLLPTLERRAGRIVANGYPTGVEVAYAMVHGGPFPATSDPRSTS
VGALAIERFLRPVCYQDLPAALLPEVLADANPLGLWRLRDGQLGKA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaccggcgagatgttgattggcgcggccgcggtgcgcggtagcgaaggcacg
atgcgcgcttacgcgccggcgcagggcgtcgagctcgagccgacgttcggcgcgggcggt
gcggccgacgtcgatcgcgcgtgccgcctcgcgaacgccgctttcgatccctttcgtcag
gcgccgctcgagacgcgcgcacgctttctcgaggcgatcgccgagcgcatcgtcgggctc
ggcgatccattgatcgaacgcgcgcacgcggaatcggcgctgcccgtcgcgcggctcgaa
ggcgagcgcgcgcgcacggtcggtcagctcaggctcttcgcggcgatcgtgcgcgacggc
cgctggctgagcgcgacgctcgattccgcgcagcccgagcgcaagccgctgccgcgcgcc
gatctgcgcttgcagaagattcccgtcggcccggtcgcggtgttcggcgcgagcaatttc
ccgctcgcgttctcggtcgcgggcggcgacaccgcttcggcgttcgcggccggctgcccc
gtcgtcgcgaaggcgcaccccgcgcatctcggcacgtcggagctcgtcgggcgcgcgatc
cggcaggctgtcgccgattgcggcttgcacgagggcgtgttctcgctcgtcgtcggcgcg
ggcaacgcgatcggcgaggcgctcgtcgcacatcccgcgatcagggcggtcggcttcacc
ggctcgcgcgcgggcggccttgcgctgatgggcgttgccgcgcggcggcgcgagccgatt
ccggtcttcgcggaaatgagcagcatcaatccgttcttcgtgttgcccggcgcgttgcgc
gcacgcggtgcgcaaatcgcgcaaggcttcgtcgaatcgctgacgctcggcgtcgggcag
ttctgcacgaacccggggctcgtcgtcgcgctcgaagggcccgacctgaaggcgttcgtc
gacgcggccgcgcaggcgctctcgcaaaagggcgcgcagacgatgctgacctcgggcatc
gcgtcgtcttacgagagcgcggtcgcggcgcgccgcgcggccgcaggcgtcagcgaggtc
gcgcgcggcgtgcgcagcgacgcgcggaacgccgcgttgcccgcgctcttcacgacgacg
cacacgcagttcgtccagaacccgcagctcgaagccgagatcttcgggccgacgtcgctc
gtcgtcgcgtgccgcgacatcgacgagatgatcgcgcttgccgagcatgtcgaggggcaa
ctgagcgcgacgctgcatctcgaagacgacgatgtcgatctggcgcgcaaactgctgccg
acgctcgagcgccgcgccggccgcatcgtcgcgaacggctatccgacgggcgtcgaggtc
gcgtacgcgatggtgcacggcgggccgtttccggcgacgtcggacccgcgcagcacatcg
gtgggcgcgcttgcgatcgagcgcttcctgcggcccgtctgctatcaggatttgccggcg
gcgttgttgcccgaggtgctcgccgacgcgaatccgctcggcctctggcgcctgcgcgac
ggccaactcggcaaggcgtga

DBGET integrated database retrieval system