KEGG   Burkholderia pseudomallei 668: BURPS668_A0166
Entry
BURPS668_A0166    CDS       T00481                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS668_A0166
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpd02044]
    BURPS668_A0166
Secretion system [BR:bpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS668_A0166
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: ABN85966
UniProt: A3NFQ1
Position
II:148425..151217
AA seq 930 aa
MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDFH
VPLATSANLDLKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREISGLVVKAGFLRCEGRYN
VYRIELRPWLWLATLTSDYKIFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARN
EPRAFQVQYGETDFDFVQRLMEEWGIYWFFEHSDNKHRLVLCDHIGGHRKAPSEAYHEIA
HHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLASLVTSNHQPRETNWGEGELFE
WPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKHKHDGANREYLV
IESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGPQSAIVVGPPGH
EVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNG
DPDRPLILGSLYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQ
AEKDMNRLTKNDESHTVGANFSIGVGLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGA
YALNVGGAHAVAVGGASSVSVGGAYARNVGGAYALTVGGVLSIVCGASSITMTACGSIKI
VGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGGAIPPIPLPSFFLDITKPILP
PPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTSSEI
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgccaaaccatttttcgaacggacggacgaatcaaagccgcacggtagtgatccgcagc
ggtgcgatgccgcggctgctcggtcagcccgcgctcgagttcctgtcgctgcgcggtgaa
gagcacctcggaaaactctacacgtacgaattgctcctgcgcacgccggacgattttcat
gttccgttggcaacgagcgcgaatctcgacctgaaggcgatgatcggcacggagatgacg
gtctgcattcagctcgacggaatcgggacgggcgcgcaaggcggcgttggcgcgggtgcg
cgcgaaatcagcgggctcgtggtcaaggcgggcttcctgcgctgcgaggggcgctacaac
gtctatcgcatcgagctgcgcccctggctgtggctcgcgactctgacgagcgactacaag
atttttcaggacaagagcgtcgtcgaaatcatcgatacggtcttgcacgattacccttac
ccggtcgagaagcggctcgacatcgacaagtattcggtggcgggcgagagcgctcgaaac
gagccgcgcgcgttccaggtgcaatatggcgaaaccgatttcgacttcgttcagcgtttg
atggaggagtgggggatctactggttcttcgagcattcggacaacaagcatcgcctggtc
ttgtgcgatcacatcggcgggcatcgcaaggcgccgagcgaggcctatcacgagatcgcg
catcacccggaaggcgggaagatcgacatcgagtacatcaactatttctcgacggacgaa
gcgctgcggcccggccgcgtcgtgatagacgatttcgacttcacgcgtccgctcgcgagc
ctcgtcacgtccaatcaccagccgcgggagacgaactggggggagggcgagctgttcgaa
tggccgggcgactataccgatagcaagcatggcgatctcatcagccgcgtgcgcatggaa
gagcgccgcgcgaccgggtcgcgcgcatacggtcggggcaacgtgcgcggcctcgcctgc
ggtcatacgttcgtgctgtcgaagcacaagcacgacggcgcgaaccgcgagtacctcgtc
atcgaatcggcgttgatgctgaccgaagtcgcggacgaaacgggcagcggctaccgctac
gaatgcgataacgaactggtcgtgcagccgtcgaacgaggtgtttcgaatgccgcgcgaa
acgcccaagccgacgacgagcgggccacagtccgcgatcgtggtcgggccgccgggccac
gaggtatggaccgacgaattcggccgcgtgaagatccgttttctgtgggatcgctacgca
cgcaatgacgcaacggattcctgctgggtacgcgtgagccaggcgtgggccggcgtgaac
ttcggcggcatctacattccgcggatcggacaggaagtgatcgtcggattcatgaacggc
gatccggaccgtccgctgattctcggcagcctctacaacaccattacgccgccgccttgg
gatctgcccggcgacgcgacgaagagcggattcaagagcaagtcgatcacgggcgggcgc
gagaactataacggcatccgcttcgaggacaagctgggggccgaggaatttcacatgcag
gcggaaaaggacatgaaccgcctgacgaagaacgacgagtcgcatacggtcggcgcgaat
ttttcgatcggcgtcgggcttacccatacgcgcgcggtgggcgccatgttcagcagcatc
gtcggcggagccgccagctatgcggtggggggcgcggaatcgacgatgatcggcggcgcg
tatgcgttgaacgtcggcggcgcgcacgcggttgcggtgggcggcgcgtcgtccgtttcc
gttggcggcgcctacgcgcgcaacgtgggcggcgcgtatgcgctgacagtcggcggcgtg
ctgtcgatcgtctgcggtgcgtcttcgatcaccatgacggcttgcggctcgatcaagatc
gtcggcaagaatattcgcatcatcggcagcgacgaagtcgtcgtgcaaggcgcgcccctg
caactgaatccgggcgattcggattgcggcggagggggcggcggcggaggcggcggcggc
gcgattccgccgattccgttgccgtcgttcttcctcgatatcacgaagccgattcttccg
ccgccgccgccgccaccgacggaggtgccaccggatccgacgccgacgccgacgccgacg
ccgacgccaacgccaacgccgacgccgacgccgacgccaacgccaacgcctacgccaacg
ccaacgccgacgccgacgccgacgccaacgccaacgccaacgccaacgccaacgccaacg
cctacgcctacgccaacgcctacgccaacgccaacgccgacgccaacgccaacgccaacg
ccaacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccaacg
ccaacgccaacgccaacgccaacgccgacgccgacgccgacgccgacgccgacgccgacg
cccacgccaacgcccacaccgacgccaacgccaacgccaacgccaacgccaacgccgacg
ccgacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccgacgccgacg
ccgacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccgacgccaacg
ccaacgccgacgccgacgccgacgccgacgcccacgccgacgccgacgccaacaccaaca
ccaacgccaactccgactagttccgagatttaa

DBGET integrated database retrieval system