KEGG   Burkholderia pseudomallei 668: BURPS668_A0174Help
Entry
BURPS668_A0174    CDS       T00481                                 

Definition
(GenBank) ImpE/SciE family protein
  KO
K11898  type VI secretion system protein ImpE
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpd02044]
    BURPS668_A0174
Secretion system [BR:bpd02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BURPS668_A0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE
Motif
Other DBs
NCBI-ProteinID: ABN87133
UniProt: A3NFQ9
Position
II:complement(161915..162721)
Genome map
AA seq 268 aa AA seqDB search
MLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQTWAGLEP
QGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTL
REAAFHCAPVTRGESAEMGSFAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAG
TLTDLVWRPVTALMLDATVLRGYAPTRYSGSENGATAIRLASETTWRDIGTTNVVALGQR
TWTTDQGDWGMLQIGGCRFTGESDDAAS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgacgcgctgcgcgcccagtctttcgaggaaatcaaggcgcgcacggccgag
gcggtcagaaagcggccatccgacacgcgggaacgctggctactgtttcagttgctttgc
atcgacggcgcgtgggagcgcgcgctcaaacagctgcaaacctgggccgggctcgagccg
cagggcgaggcgcgcgcgcaactgcatcgcggcctgatccgatgcgaaatgttccgggcc
gacgtgtttgccggcaagcgaacgccggggttcatcgacgcgcagcccgcctgggtcgac
acgctcctccaagccaatgcgaagctcggcgccggcgacgtcgcggcggcggacacgctg
cgcgaggccgcgttccactgcgcccctgtcacccgcggggaaagcgccgaaatgggaagc
ttcgcatggcttaccgacagcgacacccgcctcggtccgatcttcgaaatagcggttgca
ggcggctatcgatggattccgttcgaacaactgaagtccatcacgtttacgcccgccggc
acgctgaccgacctggtctggcggccggtcacggcactcatgctcgatgccacggttctc
cgcggctatgcacccacccgctattcgggatcggagaacggcgcgaccgcgatccgcttg
gccagcgagacgacctggcgcgacatcggcaccaccaatgtcgtggcgctcggacaacga
acatggaccaccgatcagggcgactggggcatgctccagatcggcggatgccgcttcacg
ggcgaaagcgacgatgcggcatcctga

DBGET integrated database retrieval system