KEGG   Burkholderia pseudomallei 668: BURPS668_A0285Help
Entry
BURPS668_A0285    CDS       T00481                                 

Definition
(GenBank) ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, permease protein
  KO
K10440  ribose transport system permease protein
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BURPS668_A0285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpd02000]
    BURPS668_A0285
Transporters [BR:bpd02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    BURPS668_A0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ABN86642
UniProt: A3NG20
Position
II:complement(250454..251488)
Genome map
AA seq 344 aa AA seqDB search
MNQQIKQSETAAAPPGAAQPRAPRRAADHRARMQALMRTAGMLPVLVLLCVGFGFMTDGF
FTLQNLSIVTQQASINIVLAAGMTFVILTGGIDLSVGSVLAAAAVASLLASNLPGWGWLG
IPAALAVGLAFGVVNGGLISFLRLPPFIVTLGALTAVRGIARLMGNDTTIFNPQLPFAFI
GNGSILGVPWLVVIALAVVAISWFILRRTVLGMRIYAVGGNPEAARLSGINVRGIELFVY
ASSGLLAGLGALMSAARLYAANGLQLGQSYELDAIAAVILGGTSFVGGVGSIVGTLIGAL
IIAVLSNGLVLLGVSDIWQYIIKGLVIIGAVALDRYRQHGSART
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacagatcaagcaaagcgagaccgccgccgcgccgccgggcgcggcgcagccc
cgcgcgccgcggcgcgcggccgaccaccgcgcgcggatgcaggcgctgatgcgcacggcc
ggcatgctgcccgtgctcgtgcttctgtgcgtgggcttcggcttcatgaccgacggcttc
ttcacgctgcagaacctgtcgatcgtcacgcagcaggcgtcgatcaacatcgtgctcgcc
gccggcatgacgttcgtgatcctgacgggcggcatcgacctgtcggtcggctcggtgctc
gcggccgccgcggtcgcgtcgctgctcgcgtcgaacctccccggctggggctggctcggc
attccggccgcgctcgccgtcgggctcgcgttcggcgtcgtcaacggcgggctgatctcg
tttctgcgcctgccgcccttcatcgtcacgctcggcgcgctgaccgccgtgcgcggcatc
gcgcgcctgatgggcaacgacacgacgatcttcaacccgcaactgccgttcgcgttcatc
ggcaacggctcgatcctcggcgtgccgtggctcgtcgtgatcgcgctcgccgtcgtcgcg
atctcgtggttcatcctgcgccgcacggtgctcggcatgcggatctatgcggtcggcggc
aaccccgaggccgcgcgcctgtcgggcatcaacgtgcgcggcatcgaactgttcgtctac
gcgagctccggcctgctcgccggcctcggcgcgctgatgtccgccgcgcggctgtatgcg
gccaacggcctgcagctcggccagtcgtacgaactcgacgcgatcgccgcggtgatcctc
ggcggcacgagcttcgtcggcggcgtcggctcgatcgtcggcacgctgatcggcgcgctg
atcatcgcggtgctgtcgaacgggctcgtgctgctcggcgtgtccgacatctggcagtac
atcatcaaggggctcgtgatcatcggcgcggtcgcgctcgaccgctaccgtcagcacgga
tcggcccgcacctga

DBGET integrated database retrieval system