KEGG   Burkholderia pseudomallei 668: BURPS668_A0331Help
Entry
BURPS668_A0331    CDS       T00481                                 

Gene name
sciM
Definition
(GenBank) SciM protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS668_A0331 (sciM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpd02044]
    BURPS668_A0331 (sciM)
Secretion system [BR:bpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS668_A0331 (sciM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ABN87156
UniProt: A3NG67
Structure
PDB: 

Position
II:complement(297541..298026)
Genome map
AA seq 161 aa AA seqDB search
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLTFEH
AIDRASPNLMKYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIITRVRPSGSRDDTER
SRETVSLSFAKVKQEYVVQNAQGGSGGAVTTSFDIKGNKEA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggatatttttctgaagatcgacggcatcaacggtgaatccctcgacgacagc
cacaaggacgagatcgaagtcctgaactggaactgggagattcagcaggaatcgacgatg
cacacgggcagcggcggcggcgccggcaaggcgagcgtgaaggatctgacgttcgagcac
gcgatcgaccgcgcgagccccaacctgatgaagtacgcgctgaccggcaagcacgtcgat
caggcggtgctcgtgatgcgcaaggcgggcggcaatccgctcgaatacctgaagctcacg
atgagcgacgtgatcatcacgcgcgtgcggccgtcgggcagccgcgacgacaccgagcgc
agccgcgagacggtatcgctgtcgttcgcgaaggtgaagcaggagtatgtcgtgcagaac
gcgcagggcggcagcggcggcgccgtcacgacgagcttcgacatcaagggcaacaaggaa
gcctga

DBGET integrated database retrieval system