KEGG   Burkholderia pseudomallei 668: BURPS668_A0384Help
Entry
BURPS668_A0384    CDS       T00481                                 

Gene name
acnD
Definition
(GenBank) 2-methylisocitrate dehydratase, Fe/S-dependent
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00640  Propanoate metabolism
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BURPS668_A0384 (acnD)
Enzymes [BR:bpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BURPS668_A0384 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ABN87405
UniProt: A3NGB9
Position
II:349279..351873
Genome map
AA seq 864 aa AA seqDB search
MNTANRKPLPGTSLDYFDARAAVDAIRPGAYDALPYTSRVLAENLVRRCDPAILADSLTQ
LVERKRERDFPWFPARVVCHDILGQTALVDLAGLRDAIAERGGDPAKVNPVVPVQLIVDH
SLAVECGGFDPDAFAKNRAIEDRRNEDRFHFIEWTKKAFENVDVIPPGNGIMHQINLEKM
SPVIQAQDGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIVGV
ELTGKRQPGITATDVVLALTEFLRREKVVGAYLEFRGEGAKSLTLGDRATISNMAPEYGA
TAAMFFIDEQTIDYLRLTGRSDEQVKLVETYAKAAGLWADSLAHAQYERTLTFDLSSVVR
NMAGPSNPHKRLPTSDLAARGIAGKWEEKPGEMPDGAVIIAAITSCTNTSNPRNVIAAAL
LARNANARGLARKPWVKSSLAPGSKAVELYLKAANLLPELEKLGFGIVAFACTTCNGMSG
ALDPKIQQEIVDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDALGHDKDGKPVTLKDIWPTDEEIDAIVASSVKPEQFRTVYEPMFARAADAGERAAPLY
DWRPRSTYIRRPPYWEGALAGERTLKGMRALAVLGDNITTDHLSPSNAILPTSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPTLVNEMAIVDGEVKKGSLARVEPDGKVMRM
WEAIETYMSRKQPLVVIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGMG
VLPLEFKPGTNRATLAIDGTETFDVIGERTPRADLTLVIHRSSGERVAVPVTCRLDTAEE
VSIYDAGGVLQRFAQDFLESSRAA
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgccaaccgcaaacccctgcccggcacgtcgctcgactacttcgacgcgcgc
gccgccgtcgacgcgatccgcccgggcgcgtacgacgcgttgccgtacacgtcgcgcgtg
ctcgccgagaacctcgtgcgccgctgcgatccggcgatcctcgccgattcgctgacgcag
ctcgtcgagcgcaagcgcgagcgcgatttcccgtggttcccggcgcgcgtcgtctgccac
gacatcctcggccagaccgcgctcgtcgatctcgcgggcctgcgcgacgcgatcgccgaa
cgcggcggcgatccggcgaaggtgaatccggtcgtgccggtgcaactgatcgtcgatcat
tcgctcgccgtcgaatgcggcggcttcgatcccgacgcgttcgcgaagaaccgcgcgatc
gaggatcgccgcaacgaggatcgcttccacttcatcgaatggacgaagaaggcgttcgag
aacgtcgacgtgattccgcccggcaacggcatcatgcaccagatcaatctggagaagatg
tcgcccgtgatccaggcgcaggacggcgtcgcgtacccggacacctgcgtcggcaccgac
agccacacgccgcacgtcgacgcgctcggcgtgatcgcgatcggcgtgggcgggctggag
gcggagaacgtgatgctcggccgcgcatcgtggatgcggctgcccgacatcgtcggcgtc
gagctgaccggcaagcgccagcccggcatcaccgcgaccgacgtcgtgctcgcgctgacc
gaattcctgcgccgcgagaaagtggtcggcgcgtatctggaattccgcggcgagggcgcg
aagagcctcacgctcggcgatcgcgcgacgatctcgaacatggcgcccgagtacggcgcg
accgccgcgatgttcttcatcgacgagcagacgatcgattacctgcgcttgacgggccgc
agcgacgagcaggtgaagctcgtcgaaacctacgcgaaggcggcgggcctgtgggccgac
agcctcgcgcacgcgcagtacgagcgcacgctgacgttcgacctgtcgagcgtcgtgcgc
aacatggccggcccgtcgaatccgcacaagcggctgccgacgtccgatctcgccgcgcgc
gggatcgccggcaaatgggaggagaaaccgggcgagatgcccgacggcgcggtgatcatc
gccgcgatcacgagctgcacgaacacgagcaacccgcgcaacgtgatcgccgcggcgctg
ctcgcgcgcaacgcgaacgcacgcggcctcgcgcgcaagccgtgggtgaagagctcgctc
gcgcccggctcgaaggcggtcgagctgtacctgaaggcggcgaacctgctgcccgagctg
gagaagctcggcttcggcatcgtcgcgttcgcgtgcacgacctgcaacgggatgtccggc
gcgctcgacccgaagatccagcaggagatcgtcgatcgcgacctgtacgcgacggccgtg
ctgtccggcaaccgcaacttcgacgggcgcatccatccgtatgcgaagcaggcgttcctc
gcgtcgccgccgctcgtcgtcgcatacgcgatcgcgggcacgatccgcttcgacatcgag
aaggacgcgctcggccacgacaaggacggcaagcccgtcacgctgaaggacatctggccg
accgacgaggagatcgacgcgatcgtcgcgtcgagcgtgaagcccgagcagttccgcacc
gtctacgagccgatgttcgcgcgcgcggccgacgccggcgagcgcgcggcgccgctgtac
gactggcggccgcggagcacgtacattcgccgcccgccgtactgggaaggcgcgctcgcg
ggcgagcgcacgctcaagggcatgcgcgcgctcgccgtgctcggcgacaacatcacgacc
gatcacctgtcgccgtcgaacgcgatcctgccgacgagcgcggcgggcgaatacctcgcg
aagatgggcctgcccgaagaggacttcaactcgtacgcgacgcaccgcggcgatcacctg
accgcgcagcgcgcgacgttcgcgaacccgacgctcgtcaacgagatggcgatcgtcgac
ggcgaggtgaagaagggctcgctcgcgcgcgtcgagccggacggcaaggtgatgcgcatg
tgggaggcgatcgagacctacatgtcccgcaagcagccgctcgtcgtgatcgccggcgcc
gattacggccagggctcgtcgcgcgactgggcggccaagggcgtgcggctcgcgggcgtc
gaggcgatcgtcgcggaaggcttcgagcggattcaccgcacgaacctgatcggcatgggc
gtgctgccgctcgagttcaagcccggcacgaaccgcgcgacgctcgcgatcgacggcacc
gagacgttcgacgtgatcggcgagcgcacgccgcgggccgatctcacgctcgtgattcac
cgcagcagcggcgagcgcgtggcggtgcccgtcacgtgccggctcgatacggccgaggaa
gtgtcgatctacgacgcgggcggcgtgctgcagcgcttcgcgcaggacttcctcgaatcg
tcgagggcggcgtga

DBGET integrated database retrieval system